DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CG7763

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001356891.1 Gene:CG7763 FlyBaseID:FBgn0040503 Length:232 Species:Drosophila melanogaster

Alignment Length:199 Identity:51/200 (26%)
Similarity:96/200 (48%) Gaps:27/200 (14%)


  Fly    55 FTYNSLRQNGTLWRIGNMEQRLE---------------MRLQSFQNQMETKLRALKQQIEPYMEN 104
            :.|..|  |..:..:||:::|:|               .||.:|......:|.......:.....
  Fly    34 YCYGVL--NPCIASMGNLQRRVEACEAAVAIARIALNDRRLDNFGTSTNLQLENQNTSQQLLTHG 96

  Fly   105 VKMSNKIKMS-VFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETK-- 166
            ..|..|::.: :|:::||:::|:||::|:.|..|.|.|.:||||||::..::||:. |:.:..  
  Fly    97 TAMGRKLEENEIFQQLGSKYYYIEKEEKLNWHDALDKCHKMGGHLASLQSQEELDR-FNNQLNGL 160

  Fly   167 KKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHNHCVYINS----NEMYFENCANDNY 227
            .:||:|:.::.|: :.::|...|....||.|.....|. ...||.|.:    ..|...:|..:.|
  Fly   161 NRYWIDVTNQFNE-SEFVSVTKGSKANFLSWADGEPTK-DGECVDIRTFNGKTTMNDNSCFANLY 223

  Fly   228 FACQ 231
            |.|:
  Fly   224 FICE 227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 32/106 (30%)
CG7763NP_001356891.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133874491
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5349
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.