DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CG11211

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster

Alignment Length:142 Identity:24/143 (17%)
Similarity:56/143 (39%) Gaps:22/143 (15%)


  Fly   109 NKIKMSVFKKIG-----SRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKE----------LN 158
            |...::.::|..     :.:|.:....::.|..|...|.::|..||.:.:|::          ..
  Fly    22 NNTDLTFYQKCNPLLQCNAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKE 86

  Fly   159 EIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKW---KPNLATNIHNHCVYINSNEMYF- 219
            .||...|   :|:...:..:....|....:|..|.:.:|   :|.......:.|:.:.::.::. 
  Fly    87 RIFGNRT---FWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHS 148

  Fly   220 ENCANDNYFACQ 231
            |.|...:.|.|:
  Fly   149 EPCQRKHNFICE 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/114 (18%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 21/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133875959
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.