DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Lectin-galC1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster

Alignment Length:142 Identity:31/143 (22%)
Similarity:59/143 (41%) Gaps:21/143 (15%)


  Fly   111 IKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI----FSEETKKKYWV 171
            :|...|.||...:::...: .:.|..||:.||::...|.....::|.:.:    .:..::..||.
  Fly    38 VKAEPFTKINDGYYFFGTE-SLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWT 101

  Fly   172 DINSRANDGA-SWISTLSGRDVPFLKWKPNLATNI--HNHCV---YINSNEMYFE----NCANDN 226
            ..|..|..|: .|.:  :.:.:..|:|..|...|.  ..||:   ||..:...||    .|:.|.
  Fly   102 SGNDLAKTGSHRWFT--NAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDP 164

  Fly   227 ----YFACQAEQ 234
                .:.|:|.:
  Fly   165 NSLFKYICEAPE 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/118 (22%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133875208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.