DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Acp29AB

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster

Alignment Length:233 Identity:105/234 (45%)
Similarity:143/234 (61%) Gaps:0/234 (0%)


  Fly     4 YATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYYTIENIDMHQQHWFTYNSLRQNGTLWR 68
            ||:.:..:.||||.|.:|..:||...|...||....|..||:.|.::|.:|||||:|:||.||..
  Fly     2 YASNLLYLLALWNLWDLSGGQQDIPNGKATLPSPQTPQNTIDQIGINQNYWFTYNALKQNETLAI 66

  Fly    69 IGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMP 133
            |..||.|:...|..|:.|||.:|:.||..:..:..|:|.||.|||..|:|:|||||::||.....
  Fly    67 IDTMEMRIASSLLEFKAQMEIQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQT 131

  Fly   134 WDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWK 198
            |..||.|||:|.||||||.||.||:.|.:......||:||:....:|.:::|||:||:..|:|||
  Fly   132 WFEAYVTCRKMNGHLANIQDEMELDGILALAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWK 196

  Fly   199 PNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQWA 236
            .|..|...|.||||.:.||.::.|.....|.|||:|||
  Fly   197 SNQDTKKKNQCVYIYAKEMSYDECFEKKSFVCQADQWA 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 44/100 (44%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 48/108 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133872678
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.