DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CG15818

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_609116.1 Gene:CG15818 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster

Alignment Length:230 Identity:59/231 (26%)
Similarity:109/231 (47%) Gaps:42/231 (18%)


  Fly    44 IENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRL---EMRLQSFQ-------------NQMETKLR 92
            |:::...||.|... .::.||::.::..:|.:|   ::::::.|             ..:|.||:
  Fly    53 IDHLSKEQQDWGAC-EVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKLK 116

  Fly    93 -------ALKQQIEPYMENVK------------MSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAY 138
                   ||..|::...:..:            :..|:.:..:::||||:||:|...::.|.:|.
  Fly   117 DIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAE 181

  Fly   139 DTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPN--L 201
            ..|.:||||||...:.:|.|.|..:..|..||:.:|..|..| .:||..||:...:.||:.|  .
  Fly   182 QRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQG-EFISLASGKRATYFKWRKNEPK 245

  Fly   202 ATNIHNHCVYI--NSNEMYFENCAND-NYFACQAE 233
            ..|...||.|:  :.|.|...:|..| .:|.||::
  Fly   246 YNNPTQHCAYVFGHENIMIVLSCTTDVMHFICQSD 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 35/105 (33%)
CG15818NP_609116.1 CLECT 164..278 CDD:153057 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133873701
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.