DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and lectin-37Da

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001014489.1 Gene:lectin-37Da FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster

Alignment Length:155 Identity:34/156 (22%)
Similarity:59/156 (38%) Gaps:27/156 (17%)


  Fly    96 QQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI 160
            |...||...|.|:..||:       :..:|:..|.|:.|..||:.||::...|......:|.:.|
  Fly    29 QNGNPYNLTVDMTPFIKI-------NESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAI 86

  Fly   161 F----SEETKKKYWVDINSRANDGAS-WISTLSGRDVPFLKWKPNLATNI--HNHCVYIN----- 213
            .    :...:.::|...|.....|.. |.|  :.:.|...:|.|....|.  ..||:::.     
  Fly    87 AAFLNARGDRSEHWTSGNDLGKTGTHYWFS--NAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGY 149

  Fly   214 SNEMYFENCANDNY------FACQA 232
            |.|....:....|:      :.|:|
  Fly   150 STEFQLNDRPCHNHASSLFKYICEA 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/118 (20%)
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133875181
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.