| Sequence 1: | NP_652640.1 | Gene: | lectin-29Ca / 53547 | FlyBaseID: | FBgn0040098 | Length: | 236 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001303306.2 | Gene: | CG15358 / 33366 | FlyBaseID: | FBgn0031373 | Length: | 252 | Species: | Drosophila melanogaster | 
| Alignment Length: | 256 | Identity: | 75/256 - (29%) | 
|---|---|---|---|
| Similarity: | 111/256 - (43%) | Gaps: | 47/256 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     8 IFSIFALWNFWGVSAKK------QDTSTGTNEL---PKAPMPYYTIENIDMHQQHWFTYNSLRQN 63 
  Fly    64 GTLWRIGNME------------------QRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNK 110 
  Fly   111 IKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK-YWVDIN 174 
  Fly   175 SRANDGASWISTLSGRDVPFLKWKPNLATNI--HNHCVYINSNEMYFENCANDNYFACQAE 233 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| lectin-29Ca | NP_652640.1 | CLECT | 131..231 | CDD:153057 | 36/102 (35%) | 
| CG15358 | NP_001303306.2 | CLECT | 141..245 | CDD:153057 | 36/104 (35%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45448789 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 76 | 1.000 | Inparanoid score | I5252 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D100123at33392 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003272 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100086 | |
| Panther | 1 | 1.100 | - | - | P | PTHR22802 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.900 | |||||