DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CG15358

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001303306.2 Gene:CG15358 FlyBaseID:FBgn0031373 Length:252 Species:Drosophila melanogaster

Alignment Length:256 Identity:75/257 (29%)
Similarity:111/257 (43%) Gaps:47/257 (18%)


  Fly     8 IFSIFALWNFWGVSAKK------QDTSTGTNEL---PKAPMPYYTIENIDMHQQHWFTYNSLRQN 63
            :.::|| ||....||..      ||......|.   ..:||    :::|..|:..| |.:.|:.|
  Fly     9 LLALFA-WNAHAPSAAMPSVCLLQDAPQQCGEFCLTALSPM----LDHIARHEGEW-TSSVLQAN 67

  Fly    64 GTLWRIGNME------------------QRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNK 110
            .|..|:..:|                  :.:..||...::|....||.|.          |...|
  Fly    68 ATEARLARIETLQTAMNIRQKVLQEGFPKDIVARLDRLESQQAALLRILS----------KFDRK 122

  Fly   111 IKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK-YWVDIN 174
            |....|:.||||.||:|.:.:..|.||...|||||..||.|...:||..:.::..|:: ||:||.
  Fly   123 IVAPKFELIGSRFFYIEDETRRNWTSAGSACRQMGTQLATIRSAEELAALRAKLNKERHYWLDIT 187

  Fly   175 SRANDGASWISTLSGRDVPFLKWKPNLATNI--HNHCVYINSNEMYFENCANDNYFACQAE 233
            ....:|...||. ||:...||||:.....|.  :.|||.:....||...|.:.:||.||::
  Fly   188 DLEKEGDFRISA-SGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDNKCESLSYFICQSD 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 37/103 (36%)
CG15358NP_001303306.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133874209
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.