DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CG2839

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster

Alignment Length:223 Identity:67/224 (30%)
Similarity:103/224 (46%) Gaps:41/224 (18%)


  Fly    44 IENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENV--K 106
            :|||...|:..:|.|        :||.|..|.:..|::..|...:.:|:|||.::|.:..::  |
  Fly    53 LENISEQQKEGYTAN--------FRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAK 109

  Fly   107 MSNKI-KMSV-----------------------------FKKIGSRHFYLEKQKKMPWDSAYDTC 141
            |..|: |:|:                             |:|:|||.||:|:..|..|..|...|
  Fly   110 MEIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKC 174

  Fly   142 RQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIH 206
            |:||||||:..:|:||:.|..:...:.||:|: |...|...:||.:||...|||||........:
  Fly   175 REMGGHLASPQNEEELHLISQKLDTESYWLDL-SDLTDHGQYISLVSGSKAPFLKWNKGQPNREN 238

  Fly   207 NHCVYINSNEMYFENCANDNYFACQAEQ 234
            ..||.:.........|.:...|.|||.|
  Fly   239 AQCVRVKGGLYQTFQCDHRVLFICQANQ 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 34/100 (34%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133873038
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.