DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and lectin-21Cb

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster

Alignment Length:270 Identity:71/271 (26%)
Similarity:118/271 (44%) Gaps:60/271 (22%)


  Fly     1 MYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKA------------------PMPYYTIENI 47
            |:||.|....:..|.:..|..         .|..||.                  |:..:.::| 
  Fly     1 MFKYDTYFLYLIVLLDPQGAQ---------ENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVKN- 55

  Fly    48 DMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQ---------METKLRALKQQIEPYME 103
             .|::.......|        :|:.|.:|:.......||         :.:||..|...::..:.
  Fly    56 -PHKELLGEIEGL--------VGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAIN 111

  Fly   104 NVKMS--NKIKMSV------FKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI 160
            :::.|  |...||.      |:|:|||:||:|:..:..|..|.|.||:||||||...||.||..|
  Fly   112 SLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLI 176

  Fly   161 FSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWK---PNLATNIHNHCVYINSNEMYFENC 222
            ..:...:.:|:|| |...|...:||..:|::|.:|||:   |..::..  :|.|:.:.:.|...|
  Fly   177 RKQLEARWFWLDI-SNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTA--NCAYLYAGDYYTYQC 238

  Fly   223 ANDNYFACQA 232
            ::.|:|.|||
  Fly   239 SDRNFFICQA 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 36/103 (35%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 41/113 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133872911
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.