DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CG12111

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster

Alignment Length:142 Identity:40/143 (28%)
Similarity:67/143 (47%) Gaps:21/143 (15%)


  Fly   109 NKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK----- 168
            ::|..:.|.:||..::|:|...|:.|..|...||.|..|||:|.|:.|: |...:..|.|     
  Fly    41 SEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEM-EALIKYMKAKGFKNN 104

  Fly   169 --YWVDINSRANDGA-SWISTLSGRDVPFLKWK------PNLATNIHNHCVYI-NSNEMYFE-NC 222
              :|:..|....:|| .|:|  :||.:.:..|.      .|...|  .:||:: .:.||..: ||
  Fly   105 DYFWISGNDLGTEGAFYWMS--NGRPMTYAPWNGPKQMPDNYGGN--ENCVHMFATREMINDANC 165

  Fly   223 ANDNYFACQAEQ 234
            .....:.|:|.:
  Fly   166 KIQMLYVCEATE 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 33/116 (28%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133875235
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.