DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CD209

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 HGNCID:1641 Length:404 Species:Homo sapiens

Alignment Length:182 Identity:35/183 (19%)
Similarity:71/183 (39%) Gaps:35/183 (19%)


  Fly    77 EMRLQSFQNQMETKLRALK----------QQIEPYMENVKMSNKI---------KMSVFKKIGSR 122
            |:..:|.|.::..:|..||          :|.|.|.|..::...:         :.:.|:  |:.
Human   205 ELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQ--GNC 267

  Fly   123 HFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELN--EIFSEETKKKYWVDINSRANDGA-SWI 184
            :|....|:.  |..:...|:::|..|..|...:|.|  ::.|..:.:..|:.::....:|. .|:
Human   268 YFMSNSQRN--WHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWV 330

  Fly   185 --STLSGRDVPFLK--WKPNLATNI-HNHCVYINSNEMYFENCANDNYFACQ 231
              |.|    :|..|  |......|: ...|...:.|....:.|....::.|:
Human   331 DGSPL----LPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/108 (19%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. {ECO:0000255} 16..18
Endocytosis signal. {ECO:0000255} 31..34
transmembrane domain 36..59
PilO 38..>184 CDD:294757
neck domain 60..249 10/44 (23%)
CLECT_DC-SIGN_like 256..379 CDD:153060 25/132 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.