DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Colec10

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 RGDID:1307149 Length:277 Species:Rattus norvegicus

Alignment Length:175 Identity:34/176 (19%)
Similarity:75/176 (43%) Gaps:26/176 (15%)


  Fly    64 GTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEK 128
            ||:...|        |.:....|::..:..||..:: :::||       ::..::...:.:|:.:
  Rat   116 GTICDCG--------RYRKVVGQLDISVARLKTSMK-FIKNV-------IAGIRETEEKFYYIVQ 164

  Fly   129 QKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKK----KYWVDINSRANDGASWISTLSG 189
            ::| .:..:...||..||.||...|| .:|.:.::...|    :.::.:|....:| .::.|.:.
  Rat   165 EEK-NYRESLTHCRIRGGMLAMPKDE-VVNTLIADYVAKSGFFRVFIGVNDLEKEG-QYVFTDNT 226

  Fly   190 RDVPFLKWKPNLATNIHNH--CV-YINSNEMYFENCANDNYFACQ 231
            ....:..||....::.:.|  || .::|.......|....||.|:
  Rat   227 PLQNYSNWKEGEPSDPYGHEDCVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/107 (22%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 25/119 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.