DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Asgr2

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_058885.1 Gene:Asgr2 RGDID:2161 Length:301 Species:Rattus norvegicus

Alignment Length:237 Identity:49/238 (21%)
Similarity:80/238 (34%) Gaps:46/238 (19%)


  Fly    17 FWGVSAKKQDTSTGTNELPKAPMPYYTIENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQ 81
            ||.:.....:.||.|....||         :|.|.      .|...|.|.|     |..||.:.:
  Rat    88 FWTLKETLSNFSTTTLMEFKA---------LDSHG------GSRNDNLTSW-----ETILEKKQK 132

  Fly    82 SFQNQMET----------KLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDS 136
            ..:....|          .||.|..|:..::.|......:....|.  ||.:::  .:..:.|..
  Rat   133 DIKADHSTLLFHLKHFPLDLRTLTCQLAFFLSNGTECCPVNWVEFG--GSCYWF--SRDGLTWAE 193

  Fly   137 AYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGA-SWISTLSGRDVPFLKWKPN 200
            |...|:....||..|...:|...:.........|:.:..:  ||: .|:.....|. .|..|...
  Rat   194 ADQYCQMENAHLLVINSREEQEFVVKHRGAFHIWIGLTDK--DGSWKWVDGTEYRS-NFKNWAFT 255

  Fly   201 LATNIHNH-------CVYINSNEMYFEN-CANDNYFACQAEQ 234
            ...|...|       |..|.|:.::.:| |...|.:||:.::
  Rat   256 QPDNWQGHEEGGSEDCAEILSDGLWNDNFCQQVNRWACERKR 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/109 (22%)
Asgr2NP_058885.1 Lectin_N 29..162 CDD:281887 21/94 (22%)
CLECT_DC-SIGN_like 170..295 CDD:153060 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.