DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Clec4m

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_008767168.1 Gene:Clec4m RGDID:1561466 Length:329 Species:Rattus norvegicus

Alignment Length:235 Identity:51/236 (22%)
Similarity:97/236 (41%) Gaps:41/236 (17%)


  Fly     8 IFSIFALWNF-WGVSAKKQDTSTGTNELPKAPM---PYYTIENIDMHQQHWFTYNSLRQNGTLWR 68
            :|.:|...|. |....|::......|:|....|   |....:|..|.::.......|:.. .|.|
  Rat    74 LFQVFKTTNTQWQEEPKQEKILEELNQLTDELMSRIPISQGQNESMQEKISEQLTQLKVE-LLSR 137

  Fly    69 I-------GNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENV-KMSNKIKMSVFK-------- 117
            |       .:|::::..:|...:.::.:|:.:|:.|.|...|.: :...::|..:.:        
  Rat   138 IPVFQVQNESMQEKISEQLTQLKAELLSKIPSLQVQDESKQEKIYQQLVQMKTELLRLCRLCPWD 202

  Fly   118 ---KIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKK---KYWVDINSR 176
               .:|:.:|..:.|:.  |:.|...|::....|..|..::|  :.|.:.|.|   ..|:.::..
  Rat   203 WTFLLGNCYFLSKSQRN--WNDAVRACKEEKAQLVIINSDEE--QTFLQLTSKAKGPTWMGLSDL 263

  Fly   177 ANDGASWI----STLSGRDVPFLK-WKPNLATNI-HNHCV 210
            .|: |:|:    ||||.|   |.| |......|| ...||
  Rat   264 KNE-ATWLWVDGSTLSSR---FQKYWNRGEPNNIGEEDCV 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 25/90 (28%)
Clec4mXP_008767168.1 VIP2 88..>174 CDD:294115 16/87 (18%)
CLECT_DC-SIGN_like 199..321 CDD:153060 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.