DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Sftpd

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_037010.1 Gene:Sftpd RGDID:3667 Length:374 Species:Rattus norvegicus

Alignment Length:155 Identity:34/156 (22%)
Similarity:64/156 (41%) Gaps:22/156 (14%)


  Fly    93 ALKQQIEPYMENVKMSN-KIKMSVFKK---------IGSRHFYLEKQKKMPWDSAYDTCRQMGGH 147
            ||:||:|..  |.|:.. :...|.:||         :|.:.|.....:: |::.|.:.|||.||.
  Rat   225 ALRQQMEAL--NGKLQRLEAAFSRYKKAALFPDGQSVGDKIFRAANSEE-PFEDAKEMCRQAGGQ 286

  Fly   148 LA---NILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNI--HN 207
            ||   :..:...:.::.:..:|..: :.:.....:|.....|  |..:.:..|.|....|.  ..
  Rat   287 LASPRSATENAAVQQLVTAHSKAAF-LSMTDVGTEGKFTYPT--GEALVYSNWAPGEPNNNGGAE 348

  Fly   208 HCVYINSNEMYFEN-CANDNYFACQ 231
            :||.|.:|..:.:. |.......|:
  Rat   349 NCVEIFTNGQWNDKACGEQRLVICE 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 22/106 (21%)
SftpdNP_037010.1 Collagen 41..89 CDD:189968
Collagen 66..124 CDD:189968
Collagen 114..172 CDD:189968
Surfac_D-trimer 223..268 CDD:286141 12/45 (27%)
CLECT 261..374 CDD:295302 23/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.