DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Klrb1b

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_775414.2 Gene:Klrb1b RGDID:2975 Length:223 Species:Rattus norvegicus

Alignment Length:126 Identity:28/127 (22%)
Similarity:53/127 (42%) Gaps:26/127 (20%)


  Fly   123 HFYLEK-----QKKMPWDSAYDTCRQMGGHLANILDEKELNEI--FSEETKKKYWVDINSRANDG 180
            |.:.:|     |..:.|..:...|...|..|..:.|::||..:  .::.....:|:.::...:|.
  Rat    99 HSHQDKCFHVSQTSITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDE 163

  Fly   181 A-SWI--STLSGRDVPFLKWKPNLATNI-----HNHCVYINSNEMYFENCANDNYFACQAE 233
            . .||  |||:..           |.||     .:.|..::.:::..|:|.:||.:.||.|
  Rat   164 KWKWINGSTLNSD-----------ALNITGDTEKDSCASVSQDKVLSESCDSDNIWICQKE 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/110 (21%)
Klrb1bNP_775414.2 ITIM motif 5..10
LCK-binding motif. {ECO:0000250|UniProtKB:P27812} 31..34
CLECT_NK_receptors_like 94..212 CDD:153063 27/124 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5309
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.