DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Klrd1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_036877.1 Gene:Klrd1 RGDID:2978 Length:179 Species:Rattus norvegicus

Alignment Length:140 Identity:34/141 (24%)
Similarity:65/141 (46%) Gaps:20/141 (14%)


  Fly   100 PYMENVKMSNKIKMSVFKKIGSR--HFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFS 162
            |.:|..|:| |....:.|.||.:  .:::.|::| .|..:.:.|......|..:....||:  |.
  Rat    48 PIVEFQKVS-KCCACLEKWIGHQCSCYFISKEEK-SWKGSREFCASQNSSLLQLQTRNELS--FM 108

  Fly   163 EETKKKYWVDINSRANDGASWI---STLSGRDV--PFLKWKPNLATNIHNHCV-YINSNEMYFEN 221
            ..::..:|:.|:.. .:.::|:   .|...:|:  .|.|::       .:||: |..|.|:..|:
  Rat   109 SSSQAFFWIGIHYN-EERSAWLWEDGTFPSKDLFPEFSKFR-------QDHCIGYSISREISSES 165

  Fly   222 CANDNYFACQ 231
            |.|.|.|.|:
  Rat   166 CENKNRFICK 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 25/106 (24%)
Klrd1NP_036877.1 CLECT_NK_receptors_like 61..176 CDD:153063 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5309
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.