DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Klrh1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_631926.1 Gene:Klrh1 RGDID:621452 Length:231 Species:Rattus norvegicus

Alignment Length:128 Identity:28/129 (22%)
Similarity:52/129 (40%) Gaps:20/129 (16%)


  Fly   120 GSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWI 184
            |.:.:|..:::| .||.:..:||.:|.|||.| |.:|............|||.:..:... ..|:
  Rat   112 GEKCYYFSEEEK-TWDESEASCRLLGSHLAKI-DNREEQNFIQSRLNYSYWVGLRKKGGQ-FLWV 173

  Fly   185 STLSGR---DVPFLKWKPNLATNIHN-HCVYINSNEMYFENCANDNYFACQ--------AEQW 235
            .....:   |:.|     ::.|::.: .|.||....:....|:....:.|:        :|.|
  Rat   174 HQEDEKISSDLDF-----HMTTHLADAACGYIKPKLLNNAQCSRLFPYICKKNFTCLLTSENW 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/104 (23%)
Klrh1NP_631926.1 Ly49 36..118 CDD:285577 2/6 (33%)
CLECT_NK_receptors_like 104..220 CDD:153063 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.