DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Mbl1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 RGDID:3055 Length:238 Species:Rattus norvegicus

Alignment Length:165 Identity:41/166 (25%)
Similarity:74/166 (45%) Gaps:27/166 (16%)


  Fly    76 LEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKI-KMSVFKKIGSRHFYLEKQKKMPWDSAYD 139
            :|::|.:    ||.::..||.::|       ::||: ..|:.||.|.: |::...::||:.....
  Rat    91 IEVKLAN----MEAEINTLKSKLE-------LTNKLHAFSMGKKSGKK-FFVTNHERMPFSKVKA 143

  Fly   140 TCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATN 204
            .|.::.|.:| |....|.|:...|..|...::.|.....:| .::....|| :.:..||.: ..|
  Rat   144 LCSELRGTVA-IPRNAEENKAIQEVAKTSAFLGITDEVTEG-QFMYVTGGR-LTYSNWKKD-EPN 204

  Fly   205 IH---NHCVYINSNEMYFENCANDNYFACQAEQWA 236
            .|   ..||.|..|.::       |..:|||...|
  Rat   205 DHGSGEDCVTIVDNGLW-------NDISCQASHTA 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/103 (23%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968
CLECT_collectin_like 126..236 CDD:153061 28/120 (23%)
Calcium-dependent carbohydrate binding. {ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386} 202..210 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.