DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Mbl1

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:165 Identity:41/165 - (24%)
Similarity:74/165 - (44%) Gaps:27/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKI-KMSVFKKIGSRHFYLEKQKKMPWDSAYD 139
            :|::|.:    ||.::..||.::|       ::||: ..|:.||.|.: |::...::||:.....
  Rat    91 IEVKLAN----MEAEINTLKSKLE-------LTNKLHAFSMGKKSGKK-FFVTNHERMPFSKVKA 143

  Fly   140 TCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATN 204
            .|.::.|.:| |....|.|:...|..|...::.|.....:| .::....|| :.:..||.: ..|
  Rat   144 LCSELRGTVA-IPRNAEENKAIQEVAKTSAFLGITDEVTEG-QFMYVTGGR-LTYSNWKKD-EPN 204

  Fly   205 IH---NHCVYINSNEMYFENCANDNYFACQAEQWA 236
            .|   ..||.|..|.::       |..:|||...|
  Rat   205 DHGSGEDCVTIVDNGLW-------NDISCQASHTA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/102 (23%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 28/119 (24%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.