DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Colec10

DIOPT Version :10

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:175 Identity:34/175 - (19%)
Similarity:74/175 - (42%) Gaps:26/175 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEK 128
            ||:...|        |.:....|::..:..||..:: :::||       ::..::...:.:|:.:
Mouse   116 GTICDCG--------RYRKVVGQLDISVARLKTSMK-FIKNV-------IAGIRETEEKFYYIVQ 164

  Fly   129 QKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKK----KYWVDINSRANDGASWISTLSG 189
            ::| .:..:...||..||.||...|| .:|.:.::...|    :.::.:|....:| .::.|.:.
Mouse   165 EEK-NYRESLTHCRIRGGMLAMPKDE-VVNTLIADYVAKSGFFRVFIGVNDLEREG-QYVFTDNT 226

  Fly   190 RDVPFLKWKPNLATNI--HNHCV-YINSNEMYFENCANDNYFACQ 231
            ....:..||....::.  |..|| .::|.......|....||.|:
Mouse   227 PLQNYSNWKEEEPSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/106 (22%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
gly_rich_SclB <46..>116 CDD:468478 34/175 (19%)
CLECT_collectin_like 157..272 CDD:153061 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.