powered by:
                   
 
    
    
             
          
            Protein Alignment lectin-29Ca and Clec3b
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_652640.1 | Gene: | lectin-29Ca / 53547 | FlyBaseID: | FBgn0040098 | Length: | 236 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_035736.2 | Gene: | Clec3b / 21922 | MGIID: | 104540 | Length: | 202 | Species: | Mus musculus | 
        
        
        
          
            | Alignment Length: | 107 | Identity: | 24/107 - (22%) | 
          
            | Similarity: | 44/107 -  (41%) | Gaps: | 14/107 - (13%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly   137 AYDTCRQMGGHLANILDEKELNEIF-----SEETKKKYWVDINSRANDGASWISTLSGRDVPFLK 196|.:.|...||.|.....|.|...:|     |.......|:.:|..|.:|| |:. ::|..:.:..
 Mouse    94 ASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGA-WVD-MTGGLLAYKN 156
 
 
  Fly   197 WKPNLATNIH----NHCVYIN--SNEMYFE-NCANDNYFACQ 231|:..:.|...    .:|..::  :|..:|: .|.:...:.||
 Mouse   157 WETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQ 198
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 1 | 1.050 | 53 | 1.000 | Inparanoid score | I5445 | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 1.960 |  | 
        
      
           
             Return to query results.
             Submit another query.