DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Sftpa1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_075623.2 Gene:Sftpa1 MGIID:109518 Length:248 Species:Mus musculus

Alignment Length:145 Identity:36/146 (25%)
Similarity:60/146 (41%) Gaps:20/146 (14%)


  Fly    86 QMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLAN 150
            :::|.|..:|.||...|..:.:...: :||..|:.|.:     .:.:.:|:..:.|.:.|||:|.
Mouse   106 ELQTALYEIKHQILQTMGVLSLQGSM-LSVGDKVFSTN-----GQSVNFDTIREMCTRAGGHIAA 164

  Fly   151 ILDEKELNEIFSEETKK----KYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNI-HNHCV 210
            ..:.:| ||..:..|||    .|...|..:......:   |.|..|.:..|.|...... ...||
Mouse   165 PRNPEE-NEAIASITKKYNTYPYLGVIEGQTPGDFHY---LDGASVNYTNWYPGEPRGRGKEKCV 225

  Fly   211 YINSNEMYFENCAND 225
                 |||.:...||
Mouse   226 -----EMYTDGKWND 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/101 (26%)
Sftpa1NP_075623.2 Collagen 27..98 CDD:189968
CLECT_collectin_like 136..248 CDD:153061 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.