DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and clec-149

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans

Alignment Length:224 Identity:43/225 (19%)
Similarity:86/225 (38%) Gaps:53/225 (24%)


  Fly    35 PKAPMPY----------YTIE-----------NIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEM 78
            |..|||.          :.||           .:.||.|:          .|...:|::.::.|.
 Worm   108 PPVPMPIPQISQGCNCNHDIEALEAKFDKKLYEVKMHAQY----------ETEKGVGDLRKQFET 162

  Fly    79 RLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQ 143
            .|:.::......:..:|:.:: |::..:::|.         ...:|::::::.  |.:|.:.|..
 Worm   163 DLREYERITTKDIVEIKRHLD-YLQAPRITNN---------DLEYFFIQREES--WYTASEKCIG 215

  Fly   144 MGGHLANILDEKELNEIFSEE---TKKKYWVDINSRANDGASWISTLSGRDVPFLKW-KPNLATN 204
            .|.|||:|....||.  |.:.   ..:..|:.:|....:..  .....|..|.|.|| |......
 Worm   216 YGAHLASIHSRLELG--FVQRLVPVNQTAWIGVNDIQKENV--FRNSDGTPVDFYKWGKKQPDNQ 276

  Fly   205 IHN-HCVYINSNEMYFEN-CANDNYFACQ 231
            .|| :||.::.:..:.:. |.....|.|:
 Worm   277 EHNENCVEVDHSGQWTDKLCIITRPFVCK 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/106 (25%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.891 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.