DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Mbl2

DIOPT Version :10

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_034906.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:151 Identity:33/151 - (21%)
Similarity:69/151 - (45%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLA 149
            :::::::.||:.::.      .:.|.:..|:.:|:|.::| :...|||..|.....|.:..|.:|
Mouse   102 SEIDSEIAALRSELR------ALRNWVLFSLSEKVGKKYF-VSSVKKMSLDRVKALCSEFQGSVA 159

  Fly   150 NILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKW---KPNLATNIHNHCVY 211
            ...:.:| |....:..|...::.|.....:|:  ...|:|..|.:..|   :|| .|.....||.
Mouse   160 TPRNAEE-NSAIQKVAKDIAYLGITDVRVEGS--FEDLTGNRVRYTNWNDGEPN-NTGDGEDCVV 220

  Fly   212 INSNEMYFENCANDNYFA-CQ 231
            |..|..:.:...:|::.| |:
Mouse   221 ILGNGKWNDVPCSDSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 24/103 (23%)
Mbl2NP_034906.1 Collagen 36..93 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101
CLECT 132..242 CDD:470576 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.