DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Mbl2

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 MGIID:96924 Length:244 Species:Mus musculus

Alignment Length:151 Identity:33/152 (22%)
Similarity:69/152 (45%) Gaps:15/152 (10%)


  Fly    85 NQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLA 149
            :::::::.||:.::.      .:.|.:..|:.:|:|.::| :...|||..|.....|.:..|.:|
Mouse   102 SEIDSEIAALRSELR------ALRNWVLFSLSEKVGKKYF-VSSVKKMSLDRVKALCSEFQGSVA 159

  Fly   150 NILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKW---KPNLATNIHNHCVY 211
            ...:.:| |....:..|...::.|.....:|:  ...|:|..|.:..|   :|| .|.....||.
Mouse   160 TPRNAEE-NSAIQKVAKDIAYLGITDVRVEGS--FEDLTGNRVRYTNWNDGEPN-NTGDGEDCVV 220

  Fly   212 INSNEMYFENCANDNYFA-CQ 231
            |..|..:.:...:|::.| |:
Mouse   221 ILGNGKWNDVPCSDSFLAICE 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 25/104 (24%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968
CLECT 132..242 CDD:321932 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.