DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Mbl1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_034905.1 Gene:Mbl1 MGIID:96923 Length:239 Species:Mus musculus

Alignment Length:155 Identity:40/156 (26%)
Similarity:68/156 (44%) Gaps:33/156 (21%)


  Fly    87 METKLRALKQQIEPYMENVKMSNKI-KMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLAN 150
            ||.::|.||.:::       ::||: ..|:.||.|.: .::...:|||:......|.::.|.:| 
Mouse    99 MEAEIRILKSKLQ-------LTNKLHAFSMGKKSGKK-LFVTNHEKMPFSKVKSLCTELQGTVA- 154

  Fly   151 ILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWK---PNLATNIHNH---- 208
            |....|.|:...|......::.|...|.:| .::....|| :.:..||   ||      ||    
Mouse   155 IPRNAEENKAIQEVATGIAFLGITDEATEG-QFMYVTGGR-LTYSNWKKDEPN------NHGSGE 211

  Fly   209 -CVYINSNEMYFENCANDNYFACQA 232
             ||.|..|.::       |..:|||
Mouse   212 DCVIILDNGLW-------NDISCQA 229

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 27/108 (25%)
Mbl1NP_034905.1 Collagen <37..89 CDD:189968
CLECT_collectin_like 127..237 CDD:153061 29/121 (24%)
Calcium-dependent carbohydrate binding. {ECO:0000250|UniProtKB:P19999} 203..211 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.