DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Asgr2

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001300854.1 Gene:Asgr2 MGIID:88082 Length:301 Species:Mus musculus

Alignment Length:206 Identity:41/207 (20%)
Similarity:75/207 (36%) Gaps:37/207 (18%)


  Fly    55 FTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVK------MSNKIKM 113
            |:.::|.:.|.|..:|.....:   |.|:..|:|.|.:.||......:.::|      .:...::
Mouse    98 FSSSTLMEFGALDTLGGSTNAI---LTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQL 159

  Fly   114 SVFKKIGSR-----------HFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKK 167
            :.|:..|:.           ..|...:..:.|..|...|:....||..|...:|.:.:....::.
Mouse   160 AYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQF 224

  Fly   168 KYWVDINSRANDGA-SWISTLSGRDVPFLKWKPNLATNIHNH-------CVYINSNEMYFENCAN 224
            ..|:.:..|  ||: .|:.....|. .:..|......|...|       |..|.|:..:     |
Mouse   225 HIWIGLTDR--DGSWKWVDGTDYRS-NYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHW-----N 281

  Fly   225 DNYFACQAEQW 235
            || |..|..:|
Mouse   282 DN-FCQQVNRW 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/108 (21%)
Asgr2NP_001300854.1 Lectin_N 29..162 CDD:281887 13/67 (19%)
CLECT_DC-SIGN_like 170..295 CDD:153060 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.