DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CLEC3A

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_005743.5 Gene:CLEC3A HGNCID:2052 Length:197 Species:Homo sapiens

Alignment Length:184 Identity:41/185 (22%)
Similarity:70/185 (38%) Gaps:44/185 (24%)


  Fly    75 RLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIK---------MSVFKKI-----GSRHFY 125
            ||:.|..| :.::..|...||.|||.....|....:|:         ..|.||.     |.:||:
Human    26 RLKARKHS-KRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFH 89

  Fly   126 LEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKK-------YWVDINSRANDGASW 183
                      .|.:.|...||.|....:..|:|.:  ::..|:       :|:.||....:|.  
Human    90 ----------EANEDCISKGGILVIPRNSDEINAL--QDYGKRSLPGVNDFWLGINDMVTEGK-- 140

  Fly   184 ISTLSGRDVPFLKW---KPNLATNIHNHCVYINSN---EMYFENCANDNYFACQ 231
            ...::|..:.||.|   :||  .....:||..:.:   :...|.|.:...:.|:
Human   141 FVDVNGIAISFLNWDRAQPN--GGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/113 (20%)
CLEC3ANP_005743.5 CLECT_tetranectin_like 68..193 CDD:153066 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.