DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and hbl4

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001108197.1 Gene:hbl4 ZFINID:ZDB-GENE-070912-287 Length:245 Species:Danio rerio

Alignment Length:154 Identity:31/155 (20%)
Similarity:65/155 (42%) Gaps:11/155 (7%)


  Fly    84 QNQMETKLRALKQQIEPYMENVKMSNKI-KMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGH 147
            ||.:.|:||:   .::...:.:.:.:|: ...:|||:|.: :|:.......:::|...|...|..
Zfish    96 QNALVTQLRS---DVKHLTDRLTVIDKVLGFRMFKKVGQK-YYVSDGLVGNFETAQKFCSDAGAK 156

  Fly   148 LANILDEKELNEIFS-EETKKKYWVDINSRANDGASWISTLSGRDVPFLKWK---PNLATNIHNH 208
            :.....|.|...:.| :|..:..:|.:.:...........||.:.:.|..||   || ..|....
Zfish   157 IVLPRSEDENKVLISLQEALESTYVHVGATDAKKEGHFVDLSDQPLTFTNWKEKEPN-DYNGAED 220

  Fly   209 CVYINSNEMYFE-NCANDNYFACQ 231
            |..:....::.: ||.:..:..|:
Zfish   221 CTAVYKTGVWNDINCNSKWHVVCE 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 20/105 (19%)
hbl4NP_001108197.1 Collagen 33..>92 CDD:189968
CLECT_collectin_like 131..245 CDD:153061 21/117 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.