DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and mbl2

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_571645.2 Gene:mbl2 ZFINID:ZDB-GENE-000427-2 Length:251 Species:Danio rerio

Alignment Length:115 Identity:27/116 (23%)
Similarity:52/116 (45%) Gaps:6/116 (5%)


  Fly    93 ALKQQIEPYMENVKMSNK-IKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLA--NILDE 154
            :||.:::...:.:.:..| :....|||:|.: :|:....:..:|.....|...||.|.  ..|:|
Zfish   106 SLKSELQKLSDKIALIEKVVNFKTFKKVGQK-YYVTDDVEETFDKGMQYCSSNGGALVLPRTLEE 169

  Fly   155 KELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATN 204
            ..|.::|.....|:.::.|..|..:| .::.| ..:.:.|..|.||...|
Zfish   170 NALLKVFVSSAFKRLFIRITDREKEG-EFVDT-DRKKLTFTNWGPNQPDN 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 19/77 (25%)
mbl2NP_571645.2 CLECT_collectin_like 135..248 CDD:153061 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5300
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.