DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and hbl1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_009296948.2 Gene:hbl1 ZFINID:ZDB-GENE-070912-285 Length:297 Species:Danio rerio

Alignment Length:174 Identity:31/175 (18%)
Similarity:68/175 (39%) Gaps:43/175 (25%)


  Fly    81 QSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMG 145
            :|....::::::.||.:|:...:....||      |:|:|.: :|:..:....:|:....|....
Zfish   144 ESVIESLKSEIQNLKAKIDTIEKAASFSN------FRKVGQK-YYVTDRIFGTFDNGIKLCESSS 201

  Fly   146 GHL------------------ANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDV 192
            |.|                  :.:::||....:..:||:.:: |||              .|:.:
Zfish   202 GTLVVPKSSAENQALVRVAASSGLINEKPYIGVTDKETEGQF-VDI--------------EGKQL 251

  Fly   193 PFLKWKPNLATNIH--NHCVYINSNEMYFE-NCANDNYFACQAE 233
            .|.||.|....:..  ..|..|:.:..:.: ||.:.....|:.:
Zfish   252 TFTKWGPGQPDDYQGAQDCGVIDVSGTWDDGNCGDIRPIICEID 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/121 (17%)
hbl1XP_009296948.2 CLECT 178..294 CDD:321932 22/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.