DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3021 and Trmu

DIOPT Version :8

Sequence 1:NP_652639.1 Gene:CG3021 / 53546 FlyBaseID:FBgn0040337 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_082339.1 Gene:Trmu / 72026 MGIID:1919276 Length:417 Species:Mus musculus

Alignment Length:404 Identity:169/405 (42%)
Similarity:244/405 (60%) Gaps:19/405 (5%)


  Fly     2 IRNVVVGVSGGVDSAVSAHLLAEQGFKVLGVFMRNWDEADEVGRCSGEADLKDAEWACRQLGVEL 66
            :|:||..:||||||||:|.||..:|::|.||||:|||..||.|.|:.:.|.:||...|:.|.:..
Mouse     4 LRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGVCAADKDCEDAYKVCQILDIPF 68

  Fly    67 RQVNYVREYWTAVFSQFLDDYQMGLTPNPDILCNRHIKFDLFHKHALENLGYDAVATGHYARNSL 131
            .||:||:|||..|||.||::|:.|.||||||.||:||||..|:.:|::|||.||||||||||.||
Mouse    69 HQVSYVKEYWNDVFSDFLNEYEKGRTPNPDINCNKHIKFSCFYHYAVDNLGADAVATGHYARTSL 133

  Fly   132 ---------------GNYLEGIASNNDARLLIPADTFKDQTFFLAGISRKALQRTMFPLGDFQKS 181
                           |.:.......|..:||..||:||||||||:.:|:.||:||:||||:..|.
Mouse   134 EDEEVFEQKHTKKPDGLFRNRFEVRNPVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGELTKD 198

  Fly   182 QVKDLAKKIGFQRLAKKKESTGICFVGKRNFKDFIQEYITSKRGPFLDIDSGAVVGHHEGIHQWT 246
            .||.:|.:.....:.:|:||.||||:||||.:.|:.:|:..:.|.|:.|:...|:|.|:|...:|
Mouse   199 FVKKIAAENSLHHVLQKRESMGICFIGKRNLEHFLLQYLQPRPGKFVSIEDNTVLGTHKGWFLYT 263

  Fly   247 VGQRCRLSSFLQPYFVARKEAASNTIYVASGHNHPALLSTHIAVDPPNWLCSKSQQILSDTGSLR 311
            :|||.::|...:|::|..|:.....:.||...:||||....:..:..:|:..:....|.....:.
Mouse   264 LGQRAKISGLREPWYVVEKDGTKGDVLVAPRVDHPALYRDLLRTNRVHWIAEEPPAALVRDKMME 328

  Fly   312 CRFRFQHTKPLVDCQLSISPSNTFLVELDAPLRAITPGQYAVFYDDTACLGSARIL----SANPL 372
            |.|||:|...||.|.|:::...|..|.....:|.:..||:||||....||||.:||    ||..|
Mouse   329 CHFRFRHQMALVPCVLTLNQDGTVWVTAVKAVRGLALGQFAVFYKGEECLGSGKILRLGPSAYTL 393

  Fly   373 KKKNAQTQQAQAAN 386
            :|...:|:.|..|:
Mouse   394 QKGKNRTRVAPEAS 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3021NP_652639.1 tRNA_Me_trans 14..366 CDD:281101 153/367 (42%)
tRNA_Me_trans 14..366 CDD:238956 153/367 (42%)
TrmuNP_082339.1 tRNA_Me_trans 5..383 CDD:281101 160/378 (42%)
tRNA_Me_trans 6..383 CDD:238956 159/377 (42%)
Interaction with target base in tRNA. {ECO:0000250} 96..98 2/2 (100%)
Interaction with tRNA. {ECO:0000250} 171..173 2/2 (100%)
Interaction with tRNA. {ECO:0000250} 334..335 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C236797485
eggNOG 1 0.900 E1_COG0482
Hieranoid 1 1.000
Homologene 1 1.000 H5589
Inparanoid 1 1.050 328 1.000 Inparanoid score I2427
Isobase 1 0.950 0.960964 Normalized mean entropy S1788
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004459
OrthoInspector 1 1.000 T1085659
orthoMCL 1 0.900 OOG5_127383
Panther 1 1.100 LDO PTHR11933
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1312.710

Return to query results.
Submit another query.