DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3021 and Trmu

DIOPT Version :8

Sequence 1:NP_652639.1 Gene:CG3021 / 53546 FlyBaseID:FBgn0040337 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006242226.1 Gene:Trmu / 362976 RGDID:1311229 Length:441 Species:Rattus norvegicus

Alignment Length:424 Identity:170/425 (40%)
Similarity:242/425 (57%) Gaps:43/425 (10%)


  Fly     2 IRNVVVGVSGGVDSAVSAHLLAEQGFKVLGVFMRNWDEADEVGRCSGEADLKDAEWACRQLGVEL 66
            :|:||..:||||||||:|.||..:|::|.||||:|||..||.|.|:.:.|.:||...|:.|.:..
  Rat     4 LRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEQGICAADKDCEDAYKVCQILDIPF 68

  Fly    67 RQVNYVREYWTAVFSQFLDDYQMGLTPNPDILCNRHIKFDLFHKHALENLGYDAVATGHYARNSL 131
            .||:||:|||..|||.||::|:.|.||||||.||:||||..||.:|::|||.||||||||||.||
  Rat    69 HQVSYVKEYWNDVFSDFLNEYEKGRTPNPDISCNKHIKFSCFHHYAVDNLGADAVATGHYARTSL 133

  Fly   132 ---------------GNYLEGIASNNDARLLIPADTFKDQTFFLAGISRKALQRTMFPLGDFQKS 181
                           |.:.......|..:||..||:||||||||:.:|:.||:||:||||:..|.
  Rat   134 EDEEVFEQKHTKRPDGLFRNRFEVRNPVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGELTKD 198

  Fly   182 QVKDLAKKIGFQRLAKKKESTGICFVGKRNFKDF------------------------IQEYITS 222
            .||.:|.:.....:.:||||.||||:||||.:.|                        :.:|:..
  Rat   199 FVKKIAAENRLHHVLQKKESMGICFIGKRNLEHFLLQVSVSDVSGGLLWAGAPVVMKPVFQYLQP 263

  Fly   223 KRGPFLDIDSGAVVGHHEGIHQWTVGQRCRLSSFLQPYFVARKEAASNTIYVASGHNHPALLSTH 287
            :.|.|:.|:...|:|.|:|...:|:|||.::|...:|::|..|:.....:.||...:||||....
  Rat   264 RPGKFISIEDNRVLGTHKGWFLYTLGQRAKISGLSEPWYVVEKDGTKGDVLVAPRVDHPALYRDL 328

  Fly   288 IAVDPPNWLCSKSQQILSDTGSLRCRFRFQHTKPLVDCQLSISPSNTFLVELDAPLRAITPGQYA 352
            :..:..:|:..:....|.....:.|.|||:|...||.|.|:::...|..|.....:|.:..||:|
  Rat   329 LRTNRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVKAVRGLALGQFA 393

  Fly   353 VFYDDTACLGSARIL----SANPLKKKNAQTQQA 382
            |||....||||.:||    ||..|:|...:|:.|
  Rat   394 VFYKGEECLGSGKILRLGPSAYTLQKGKNRTRVA 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3021NP_652639.1 tRNA_Me_trans 14..366 CDD:281101 155/391 (40%)
tRNA_Me_trans 14..366 CDD:238956 155/391 (40%)
TrmuXP_006242226.1 tRNA_Me_trans 5..407 CDD:281101 162/402 (40%)
tRNA_Me_trans 6..407 CDD:238956 161/401 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C236797861
eggNOG 1 0.900 E1_COG0482
Hieranoid 1 1.000
Homologene 1 1.000 H5589
Inparanoid 1 1.050 318 1.000 Inparanoid score I2423
OMA 1 1.010
OrthoDB 1 1.010 D445034at33208
OrthoFinder 1 1.000 FOG0004459
OrthoInspector 1 1.000 T1089202
orthoMCL 1 0.900 OOG5_127383
Panther 1 1.100 LDO PTHR11933
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.