DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and spsb3

DIOPT Version :8

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001017350.1 Gene:spsb3 / 550104 XenbaseID:XB-GENE-971062 Length:360 Species:Xenopus tropicalis

Alignment Length:300 Identity:104/300 (35%)
Similarity:144/300 (48%) Gaps:55/300 (18%)


  Fly     2 SDVEVDPQQAH-PHPIAAIAPRRRRPTGRRGGVTGGLSSGSLDASSSTSPPPRFCPLPN------ 59
            |:.:.|....| |..|.:..|           |||   ....|..|...|   :|...:      
 Frog    45 SNSDSDTDLLHLPPSIPSAVP-----------VTG---ESYCDCDSQNDP---YCSSLHTFHQIK 92

  Fly    60 ----GVEDN---WTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVS 117
                |.|||   |.|....:|...||...| |.|.||..:|.|||.::|.|.|..|:|:||:.::
 Frog    93 SCQCGEEDNYFDWVWDDCSKSTATVLSCDN-RKVSFHMEYSCGTAAIRGNRMLTEGQHFWEIKMT 156

  Fly   118 QRVFGTSIMFGIGTKSARL--HANAFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQ 180
            ..|:||.:|.||||....|  :.:.|.::||::...||||:.|:|.|:|....::.||  .|.:.
 Frog   157 SPVYGTDMMVGIGTSDVNLDKYRHTFCSLLGKDAESWGLSYTGLLQHKGDKSNFSSRF--GQGSI 219

  Fly   181 IGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTL--KCTRREFVNLQDR 243
            |||..|...|.|||||:.||:|||...|.  ::.|:|:|||||||:.|.:  .|..|  .:||..
 Frog   220 IGVHLDTWHGVLTFYKNRKCIGVAATQLR--NKKLFPMVCSTAAKSSMKVIRSCCCR--TSLQYL 280

  Fly   244 CRAVIMRRVR-----SAAQLEKLKLPLPIADYLSEVIDEK 278
            |.|    |:|     |...||.|.||    ..|.:|:..|
 Frog   281 CCA----RLRQLLPDSVDSLEVLPLP----PGLKQVLGNK 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 77/192 (40%)
SOCS 240..273 CDD:295349 13/38 (34%)
spsb3NP_001017350.1 SPRY_SOCS3 104..286 CDD:293936 77/193 (40%)
SOCS 276..309 CDD:295349 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3953
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.