| Sequence 1: | NP_001260073.1 | Gene: | SP555 / 53471 | FlyBaseID: | FBgn0260470 | Length: | 301 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002936603.1 | Gene: | spsb1 / 100380153 | XenbaseID: | XB-GENE-944621 | Length: | 273 | Species: | Xenopus tropicalis | 
| Alignment Length: | 285 | Identity: | 75/285 - (26%) | 
|---|---|---|---|
| Similarity: | 121/285 - (42%) | Gaps: | 73/285 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    33 VTGGLSSGSLDASSSTSPPPR-------FC------------PLPNGVEDNWTWSKRHRSKEVVL 78 
  Fly    79 RGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRN 143 
  Fly   144 MLGENEHGWGLS-HKGVLWHEGVALLYTKRFRENQPTQ-----------------IGVLFDGIEG 190 
  Fly   191 TLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVN--------LQDRCRAV 247 
  Fly   248 IMRRVRSAAQLEKLK----LPLPIA 268  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| SP555 | NP_001260073.1 | SPRY_SOCS3 | 64..249 | CDD:293936 | 56/210 (27%) | 
| SOCS | 240..273 | CDD:295349 | 14/33 (42%) | ||
| spsb1 | XP_002936603.1 | SPRY_SOCS1-2-4 | 54..227 | CDD:293963 | 51/190 (27%) | 
| SOCS_SSB1_4 | 232..272 | CDD:239688 | 14/38 (37%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||