DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP555 and spsb1

DIOPT Version :9

Sequence 1:NP_001260073.1 Gene:SP555 / 53471 FlyBaseID:FBgn0260470 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002936603.1 Gene:spsb1 / 100380153 XenbaseID:XB-GENE-944621 Length:273 Species:Xenopus tropicalis


Alignment Length:285 Identity:75/285 - (26%)
Similarity:121/285 - (42%) Gaps:73/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VTGGLSSGSLDASSSTSPPPR-------FC------------PLPNGVEDNWTWSKRHRSKEVVL 78
            ||||:.  ::|.......|.:       :|            |:.:.|:...:|:...||..|.:
 Frog     5 VTGGIK--TVDMRDPAYRPLKQDLQGLDYCKPARLDLLLDMPPVSHEVQLQHSWNNNDRSLNVFV 67

  Fly    79 RGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHANAFRN 143
            :..:....|.|| .::.|..::||.....|.|.||:....|..||..:.|:.|..|.||:..:..
 Frog    68 KEDDKLVFHRHP-VAQSTDAIRGKIGYTRGLHVWEITWVMRQRGTHAVVGVATADAPLHSVGYTT 131

  Fly   144 MLGENEHGWGLS-HKGVLWHEGVALLYTKRFRENQPTQ-----------------IGVLFDGIEG 190
            ::|.|...||.. .:..|:|:|          :|||::                 ..|:.|..:|
 Frog   132 LIGSNGKSWGWDLGRNKLYHDG----------KNQPSRTYPAFLEPDETFIVPDSFLVVLDMDDG 186

  Fly   191 TLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVN--------LQDRCRAV 247
            ||:|..||:.:|:|||||.  .:.|||:|.:.....|:.::     ::|        |.|.||  
 Frog   187 TLSFVVDGQYMGIAFRGLK--GKKLYPVVSAVWGHCEIKMR-----YLNGLDPEPLPLMDLCR-- 242

  Fly   248 IMRRVRSAAQLEKLK----LPLPIA 268
              |.||.|...::|.    ||||.|
 Frog   243 --RSVRLALGKDRLNEIQALPLPAA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP555NP_001260073.1 SPRY_SOCS3 64..249 CDD:293936 56/210 (27%)
SOCS 240..273 CDD:295349 14/33 (42%)
spsb1XP_002936603.1 SPRY_SOCS1-2-4 54..227 CDD:293963 51/190 (27%)
SOCS_SSB1_4 232..272 CDD:239688 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.