DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQL4

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_016869480.1 Gene:RECQL4 HGNCID:9949 Length:1320 Species:Homo sapiens

Alignment Length:1629 Identity:451/1630 (28%)
Similarity:652/1630 (40%) Gaps:526/1630 (32%)


  Fly    16 RVKVWEKDFKKKNGRVPSKYDIRDASQEIRDSYKMYYKLKTSFLEETLNDVLSEDGYDILEMSQA 80
            |::.||:.|:::.||.||:.|:..|.:|.|..|:.|..||.:                       
Human    10 RLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRT----------------------- 51

  Fly    81 SDFGVSMLDQDVSLNEGPQLPLDISALVGPQSSGNL---EEIPQSVEGSFSNLIDLPNRQVLTNL 142
                                       .| |:.|.|   |.:|                      
Human    52 ---------------------------TG-QAGGGLRSSESLP---------------------- 66

  Fly   143 VNRDENHVIRKFEAVEELPINQNAWGLNVSKKPPAPPQPVEASKSAPGHGKQ---PKAGASLKPS 204
                        .|.||.| ....||.::::.....||      |.||..:|   |..|..||.:
Human    67 ------------AAAEEAP-EPRCWGPHLNRAATKSPQ------STPGRSRQGSVPDYGQRLKAN 112

  Fly   205 LSAKLFQSSRGFAKRNPRKPLSRCVSSSSSTTSLSSVPTDHHEELLDFETILIRKAQEYKEKQQA 269
            |...| |:.....:|  ..||.|..|.:|:.....:.|.....|.:..|...:.:.|....:.| 
Human   113 LKGTL-QAGPALGRR--PWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQ- 173

  Fly   270 IANNPMLASEHSKESIKT---LVDDGWLRRNTKENTLDEEVPFAEANNNSGTSKKTNFGLANLDL 331
                      |.:.|:..   .:|.|||:|      ...|||     :..|..|           
Human   174 ----------HLQASLSQRLGSLDPGWLQR------CHSEVP-----DFLGAPK----------- 206

  Fly   332 SKLKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHTPPASSQKSVAPK-NKPPPSEQ 395
             ..:|.:..|:.....|.:.|::             .|...:..|.||:.:.|:.: ..|.||. 
Human   207 -ACRPDLGSEESQLLIPGESAVL-------------GPGAGSQGPEASAFQEVSIRVGSPQPSS- 256

  Fly   396 ETDSDSDSVVAESEEEQEPQEYRQLSKRRKIVSTASGKVEVAAPVEIPNKVEPETETFAQENPDF 460
                      :..|:.:..:|                      |.|.|.:|:.|:   :|..|  
Human   257 ----------SGGEKRRWNEE----------------------PWESPAQVQQES---SQAGP-- 284

  Fly   461 SADEDQDATYVPENKKKDKAKRKQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEKKPRNSKK 525
                                                                       |.....
Human   285 -----------------------------------------------------------PSEGAG 290

  Fly   526 AIAVEPAPDPEEDERQPLNPEDLKYVLALEAGDITSVPRINVQDLEEADATAQRYIRTFAAGPNP 590
            |:|||..|..|..:.||..|              .|.|                        .||
Human   291 AVAVEEDPPGEPVQAQPPQP--------------CSSP------------------------SNP 317

  Fly   591 ---GLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKKQQWR 652
               |||..|..|..:....|...:..|:|... ..|:|.:|:::|.:||| :::.....:||.|:
Human   318 RYHGLSPSSQARAGKAEGTAPLHIFPRLARHD-RGNYVRLNMKQKHYVRG-RALRSRLLRKQAWK 380

  Fly   653 HKKRVAALSGPDMDMGGCDGG----VLT---CFQCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSP 710
            .|.|         ..|.|.||    |.|   ||......|:|.||                 |.|
Human   381 QKWR---------KKGECFGGGGATVTTKESCFLNEQFDHWAAQC-----------------PRP 419

  Fly   711 FPTLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEVQQHPDPNWS 775
                                                      :.|:|.::.|.|.:...|.|   
Human   420 ------------------------------------------ASEEDTDAVGPEPLVPSPQP--- 439

  Fly   776 SDEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGV 840
                                                   :||    ...||.|           |
Human   440 ---------------------------------------VPE----VPSLDPT-----------V 450

  Fly   841 KPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLP 905
            .|||.|.|.|.:.:|..||.:||...||..||.||:||:||.|||:|:|:.|.||:|||||||||
Human   451 LPLYSLGPSGQLAETPAEVFQALEQLGHQAFRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLP 515

  Fly   906 AYLYSRKVGAITLVISPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMKIQQMIANGEIDILLVS 970
            |.||||:...:|||:|||:|||:|||:|:|..|:|.|:|:..|..||..:.|.|...::.:|:::
Human   516 ALLYSRRSPCLTLVVSPLLSLMDDQVSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLT 580

  Fly   971 PEAVVAGERATGFGAI--LRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLG 1033
            |||:|      |.|.:  ..||||:||||||||||:|||||||||.||.:|||||:.:||...||
Human   581 PEALV------GAGGLPPAAQLPPVAFACIDEAHCLSQWSHNFRPCYLRVCKVLRERMGVHCFLG 639

  Fly  1034 LTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVSKDENRDAALLQLLNSERFEPCQSI 1098
            ||||||..|...:..||.::: |..:....|:|.||.||||.|.:.|.|||.||..:||:...||
Human   640 LTATATRRTASDVAQHLAVAE-EPDLHGPAPVPTNLHLSVSMDRDTDQALLTLLQGKRFQNLDSI 703

  Fly  1099 IIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVN--------WQ---------------- 1139
            ||||.||::.||||..:|||:.....|........:.|:        |.                
Human   704 IIYCNRREDTERIAALLRTCLHAAWVPGSGGAAWTELVSPWTHLGHTWSHPTDHLPVFPKGRAPK 768

  Fly  1140 --AEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIG 1202
              ||.|||||.:..||.||:|||..:||:||||:|||||:::||:|||:|..:|.:||||||.:|
Human   769 TTAEAYHAGMCSRERRRVQRAFMQGQLRVVVATVAFGMGLDRPDVRAVLHLGLPPSFESYVQAVG 833

  Fly  1203 RAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIFVPCSC-------DKEASK 1260
            ||||||.|:||||||..:|.|..||||||:::|.|...:::|:|::|..|:|       ::|.:.
Human   834 RAGRDGQPAHCHLFLQPQGEDLRELRRHVHADSTDFLAVKRLVQRVFPACTCTCTRPPSEQEGAV 898

  Fly  1261 RTALPIP------------LEGDGPRVHMCPGHEIGFSVEKTVEMLDIPAEN------------- 1300
            ....|:|            ....||| .:|.|||....::.||:.||:|.|.             
Human   899 GGERPVPKYPPQEAEQLSHQAAPGPR-RVCMGHERALPIQLTVQALDMPEEGEEPGVSHRGVEGL 962

  Fly  1301 ------------ISTLLCYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIAL 1353
                        |.|||||:||.|...:.:|::.|...::...|||..|:..|..|||||:.:|.
Human   963 SPRPLSPALPPAIETLLCYLELHPHHWLELLATTYTHCRLNCPGGPAQLQALAHRCPPLAVCLAQ 1027

  Fly  1354 QIRDKTFKEDSNIIEFSVTDIAAGIGWNSGVVKYQLKDLEW--VKVNGYPKRSPITVSFYDLGFR 1416
            |:.:.. .:.|:.:||.:..:...:||....|:..|..|:|  ....|..:.:.:.|.|.:|.|.
Human  1028 QLPEDP-GQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGVRRGTGVLVEFSELAFH 1091

  Fly  1417 IKVPGDFTESEIDNALDTLYTRSVKQERTQLIQLQYVAHGLAAVAYSSCGQCCNADFPQDRGEQL 1481
            ::.|||.|..|.|...|.||.|...:||..|.:|:.......:||:.|||.|.... .::|..:|
Human  1092 LRSPGDLTAEEKDQICDFLYGRVQARERQALARLRRTFQAFHSVAFPSCGPCLEQQ-DEERSTRL 1155

  Fly  1482 KAIVRNYFANDYPQDLELEIEPSNVPDENIIDDVHALINMYPDNTFTGRNIARIFHGIMSPNYPA 1546
            |.::..||..:..|      ||..:.|....:...|.::.....:.:|..:            |.
Human  1156 KDLLGRYFEEEEGQ------EPGGMEDAQGPEPGQARVSAVRPGSSSGLQV------------PW 1202

  Fly  1547 VIWG 1550
            ..||
Human  1203 AAWG 1206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 193/382 (51%)
DEAD 872..1039 CDD:278688 98/169 (58%)
HELICc 1073..1216 CDD:238034 79/169 (47%)
RECQL4XP_016869480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338388580
eggNOG 1 0.900 E1_COG0514
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 632 1.000 Inparanoid score I826
Isobase 1 0.950 0 Normalized mean entropy S4803
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D367596at33208
OrthoFinder 1 1.000 FOG0004747
OrthoInspector 1 1.000 T1074769
orthoMCL 1 0.900 OOG5_131869
Panther 1 1.100 LDO PTHR13710
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5620
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.