DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQL5

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_005257875.1 Gene:RECQL5 HGNCID:9950 Length:1012 Species:Homo sapiens

Alignment Length:436 Identity:144/437 (33%)
Similarity:217/437 (50%) Gaps:75/437 (17%)


  Fly   835 SQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKG-QDRAIMRTLSGLSSL-VTLSTGSG 897
            |.|....| :|  |:..|:.|..:|      ||..:|:.. |:.|.|..:.|...: |.:.||:|
Human     2 SSHHTTFP-FD--PERRVRSTLKKV------FGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAG 57

  Fly   898 KSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHFL----RAHCLHTNQTAPQRMKIQQM 958
            |||||||||.|    ...||:|:|||::|::||   |.|.|    |...|::..:|.:|   :::
Human    58 KSLCYQLPALL----AKGITIVVSPLIALIQDQ---VDHLLTLKVRVSSLNSKLSAQER---KEL 112

  Fly   959 IANGEID-----ILLVSPE-AVVAGERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLM 1017
            :|:.|.:     ||.::|| |..:..:.|....:.|.|  :::..:|||||||||.|:|||.||.
Human   113 LADLEREKPQTKILYITPEMAASSSFQPTLNSLVSRHL--LSYLVVDEAHCVSQWGHDFRPDYLR 175

  Fly  1018 ICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLP---DNLVLSVSKDE-- 1077
            : ..||..||....:.||||||...:..:...|.:    :..::....|   .||...|...|  
Human   176 L-GALRSRLGHAPCVALTATATPQVQEDVFAALHL----KKPVAIFKTPCFRANLFYDVQFKELI 235

  Fly  1078 -----NRDAALLQLLNSERFEPCQSI-IIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRV 1136
                 |.....|:.|..|..:..... |:||..|:.||::| ...:|               :.|
Human   236 SDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLA-IELSC---------------RGV 284

  Fly  1137 NWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEI 1201
            |  |:.||||:.||.|..||..:|..::.::||||:||||::|.::|.|.|:|:.::...|.||.
Human   285 N--AKAYHAGLKASERTLVQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQES 347

  Fly  1202 GRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQK 1247
            |||||||.||.|.|:......||...        :.|..:.||.:|
Human   348 GRAGRDGKPSWCRLYYSRNDRDQVSF--------LIRKEVAKLQEK 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 130/377 (34%)
DEAD 872..1039 CDD:278688 68/179 (38%)
HELICc 1073..1216 CDD:238034 54/151 (36%)
RECQL5XP_005257875.1 DEXDc 22..229 CDD:214692 77/230 (33%)
DEAD 31..201 CDD:278688 69/183 (38%)
HELICc 246..362 CDD:238034 51/134 (38%)
RecQ_Zn_bind 367..434 CDD:292742 6/28 (21%)
RecQ5 625..826 CDD:284397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.