DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and SLD2

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_012814.1 Gene:SLD2 SGDID:S000001591 Length:453 Species:Saccharomyces cerevisiae

Alignment Length:586 Identity:117/587 (20%)
Similarity:204/587 (35%) Gaps:217/587 (37%)


  Fly     5 VFKLKYQKYKLRVKVWEKDFKKKNGRVPSKYDIRDASQEIRDSYKMYYKLKTSFLEETLNDVLSE 69
            ::..:..|.|:.:|.||.||..||.|.|::.||: :.:.:|..||.|..||..            
Yeast     1 MYSFELDKLKIELKTWEHDFIDKNKREPTRDDIK-SLRTVRQMYKQYSTLKKK------------ 52

  Fly    70 DGYDILEMSQASDFGVSMLDQDVSLNEGPQLPL-----DISALVG--PQSSG--------NLEEI 119
                           .|:..|.|...|..:||.     |....:|  ||..|        ||..|
Yeast    53 ---------------QSLQRQKVDTQESVELPAHKKDHDEVVEIGPTPQVYGKAISIFDMNLSPI 102

  Fly   120 PQSVEGSFSNLIDL-------------PNRQVLTNLVNRDENHVIRKFEAVEELPINQNAWGLNV 171
             :.:..:|:|.||:             |.:.:|......|...|.....:|:. .:|......:.
Yeast   103 -KPIYMTFTNNIDVNNDNSKTISNESSPRKTILLKSSPADRTLVAEPISSVKR-QLNFQMLNASS 165

  Fly   172 SKKPPAPP------QPVEASKSAPGHGKQPKAGASLKPSLSAKLFQSSRGFAKRNPRKPLS---- 226
            ::.|.:.|      :.||..|.:|          ::.|.|     :|.:......|..||.    
Yeast   166 TRTPTSSPCKNRNGKLVEIKKCSP----------TINPPL-----ESGKPSGYYGPNSPLKLDEE 215

  Fly   227 ---RCVSSSSST--------TSLSSVPTDHHEELLDFETI-----LIRKAQEYKEKQQAIANNPM 275
               ..:|.:|||        .||...|:   ::..|..|.     |||:              |:
Yeast   216 NIHLNISLNSSTKRRLQIAYPSLQKTPS---KDQADISTSFSPSPLIRR--------------PL 263

  Fly   276 LAS--EHSKESIKTLVDDGWLRRNTKENTLDEEVPFAEANNNSGTSKKT---NFGLANLDLSKLK 335
            ..|  |.::|..:.:.:.|.|    :|..::||....|..|  |..:|.   :|||         
Yeast   264 TKSLIELAREHTEIVKEFGVL----QEEDIEEEEEGEEGEN--GYDEKNHEDDFGL--------- 313

  Fly   336 PTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHTPPASSQKSVAPKNKPPPSEQETDSD 400
                |:::::.|     :::::                                    .||.|.:
Yeast   314 ----EDELIRPK-----VVKDI------------------------------------FQEDDDN 333

  Fly   401 SDSVVAESEEEQEPQEYRQLSKRRKIVSTASGKVEVAAPVEIPNKVEPETETFAQENPDFSADED 465
            .||      :.:|....|:..||||::......             :|||||         |..:
Yeast   334 DDS------QAREDTFIRKRPKRRKVIRRLRDN-------------DPETET---------AGFE 370

  Fly   466 QDATYVPENKKKDKAKRKQAAGKQKTTKPKAEPKPKTEKKAK---VKAEKKPKAEKKPRNSKKAI 527
            :|.     :|:..|.||::.|....:|...::.:.:.:.:|.   |.:|:||.|::|.|.....:
Yeast   371 RDV-----HKELVKLKRRKVAEFLGSTSQISDTEFEHDPEASSGVVSSEQKPTAKRKGRKKYNLV 430

  Fly   528 A 528
            :
Yeast   431 S 431

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588
DEAD 872..1039 CDD:278688
HELICc 1073..1216 CDD:238034
SLD2NP_012814.1 Drc1-Sld2 6..453 CDD:288555 117/582 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.