DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQ4B

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_176289.7 Gene:RECQ4B AraportID:AT1G60930 Length:1150 Species:Arabidopsis thaliana

Alignment Length:1235 Identity:267/1236 (22%)
Similarity:447/1236 (36%) Gaps:395/1236 (32%)


  Fly   416 EYRQLSKRRKIVSTASGKVEVAAPVEIPNKVEPETE-------------TFAQENPDFSADEDQD 467
            |.::|.:.|::   |:..:|..|||.:.....|:.|             |:.:  |..:...|.|
plant    71 ESQKLGRDREM---AARSIENIAPVTVQTLARPQIEKAWCTLINLSINNTYLR--PGITPAIDND 130

  Fly   468 ATYVPENKKKDKAKRKQAAGKQKTTKPKAEP-KPKTEKKAKVKAEKKPK-AEKKPRNSKKAIAVE 530
            :|                   .:|:..|... |..:.......|...|: :::..|.:.|:|   
plant   131 ST-------------------SRTSSTKGSTFKVTSNADGSFCAHNHPEHSQRSVRGTAKSI--- 173

  Fly   531 PAPDPEEDERQPLNPEDLKYVLALEAGDITSVPRINVQDLEEADATAQRYIRTFAAGPNPGLSEG 595
                   |.....:..|.|.:       |..|||:|.:..:....|                 .|
plant   174 -------DSFSSSSVGDNKII-------IDKVPRVNYEVRDSVTVT-----------------NG 207

  Fly   596 SNIRVDEKRAAARKKLEER-IAAGKLNENFV--TINIQK----------------KKFVRGKKSV 641
            ..:...:..|...:.:|.| ::.|:::.:.:  .|::.:                .|||    .:
plant   208 MEMPPIKNSAQLARPVEPREVSLGEIDYDDIMEIIDVDQIAMEHCPSTCTKQPSVSKFV----DI 268

  Fly   642 NFSKYKKQQWRHKKRVAALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEE 706
            ..|:.:::|          ..|......|..|:.... |.......:|.|   |:||.:|.::.:
plant   269 FTSRREEEQ----------GLPPEICSNCSHGIKLGL-CPEASTHVEQMK---DTLLAISNEILD 319

  Fly   707 D-----PSPFPTLAE----AQEMASQGAVVAHSRNISR---------------LPQAANAAILQG 747
            :     |.....|.:    .::...|..::.|::...:               .||..|..::.|
plant   320 NTYDLGPDHVEQLHQKRLLLKKQIQQLEILIHNKERKKSQCLVSIPSHNTQYETPQTTNLEVVYG 384

  Fly   748 DELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVG 812
                   :.|..:...|:.:...| ||:                                     
plant   385 -------QTDSPTHVKEQGRCVTD-NWN------------------------------------- 404

  Fly   813 HKIPEEFL-KQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQD-----------TTPEVLEALHM 865
              :|.::| .:...|.::.|..|.|  .|..:.|:....|..|           ...||...| :
plant   405 --MPRDYLVSKERYDISSGSEEREQ--SVSEVIDVTDTESSNDKKWTSSDFPWTKNLEVYNKL-V 464

  Fly   866 FGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQ 930
            ||:.:||..|...|..|:||....|.:.||.||||.|||||.|    ...|||||||||||::||
plant   465 FGNHSFRPNQREIINATMSGCDVFVLMPTGGGKSLTYQLPALL----CAGITLVISPLVSLIQDQ 525

  Fly   931 VTGVPHFLRAHCLHTNQTA---------PQRMKIQQMIAN--GEIDILLVSPEAVVAGERATGFG 984
            :..:        |.||.:|         .::::|.|.:::  .:..:|.|:||.|...|......
plant   526 IMNL--------LQTNISAASLSAGMEWAEQLEILQELSSEKSKYKLLYVTPEKVAKSESLLRHL 582

  Fly   985 AILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINH 1049
            .||.....:|...||||||||||.|:|||.|..: .||::......:|.||||||...:..::..
plant   583 EILNSRSLLARFVIDEAHCVSQWGHDFRPDYQGL-GVLKQKFPNIPMLALTATATTSVKEDVVQA 646

  Fly  1050 LGISDGERGIISDIPLPD-----NLVLSVSKDENRDAA-LLQLLNSERFEPCQSIIIYCTRRDEC 1108
            |       |:::.:....     ||..||....|:... :.:.:....|:.|.  ||||..|.:|
plant   647 L-------GLVNCVVFRQSFNRPNLWYSVVPKTNKCLEDIDKFIRENHFDECG--IIYCLSRMDC 702

  Fly  1109 ERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAF 1173
            |::...:|.                  ...:|..||..|...:|..|||.:..:|:.|:.||:||
plant   703 EKVTEALRV------------------FGHKAAFYHGSMDPGKRAFVQKQWSKDEINIICATVAF 749

  Fly  1174 GMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLF-----------LDAKGG----- 1222
            ||||||||:|.|||:::|::.|.|.||.|||||||..|.|.|:           :.::||     
plant   750 GMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYSYTDYIRVKHMISQGGLGQGQ 814

  Fly  1223 ------------------DQSELRRHVY-SNSIDRHVIRKLLQKIFV-------PC--SCDKEAS 1259
                              .::.||...| .|.:|   .|:.||.:.:       .|  :||..:|
plant   815 MKMGYNCKASSGRMLETNTENLLRMVSYCENEVD---CRRFLQLVHLGEKFDSTNCKNTCDNCSS 876

  Fly  1260 KRTALP-------------IPLEG-------------------------DGPRVHMCPGHEIGFS 1286
            .:..:.             :.|.|                         |...:|....|.....
plant   877 SKILIDKDVTVIARQLVALVKLTGERFSSAHIVEIYRGSLNQSVKRNRQDTLHLHGAGKHLTKSE 941

  Fly  1287 VEKTVEML---DIPAENISTLLCY------MELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAK 1342
            ..:.:..|   ||.||.:.....|      ::::.....|:||.    .:.|:...|..:| .:|
plant   942 ASRILHYLVTEDILAEGVKKSELYGSVSSLLKVNRSKAASLLSG----GQSITMRFPSTIK-VSK 1001

  Fly  1343 ECPPLAMAIALQIRDKTF------KEDSNIIEFSVTDIAAGIGWNSGVVKYQLKDLEWVKVNGYP 1401
            :....|....:.::..|.      .:|||:               ||::...||:|.    ....
plant  1002 QSKSTANPAKVPLKQTTLPMAKAAPQDSNL---------------SGILLTALKNLR----TDIV 1047

  Fly  1402 KRSPITVSFYDLGFRIKVPGDFTESEIDNALDTLYTRSVKQERTQLIQLQYVAHGLAAVAYSSCG 1466
            |.||      ||.....:.|:.|..||        ::.:.:.:.:|:.:    :||.....|..|
plant  1048 KESP------DLVMAYHIFGNATLKEI--------SKRLPRTKEELLDI----NGLGKAKVSKYG 1094

  Fly  1467  1466
            plant  1095  1094

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 132/382 (35%)
DEAD 872..1039 CDD:278688 70/178 (39%)
HELICc 1073..1216 CDD:238034 53/144 (37%)
RECQ4BNP_176289.7 PLN03137 14..1150 CDD:215597 267/1236 (22%)
DEAD 471..641 CDD:278688 71/183 (39%)
HELICc 666..792 CDD:238034 54/146 (37%)
RecQ_Zn_bind 797..874 CDD:292742 13/80 (16%)
RQC 883..994 CDD:286470 15/115 (13%)
HRDC 1035..1101 CDD:278967 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.