DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQL2

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_174421.3 Gene:RECQL2 AraportID:AT1G31360 Length:739 Species:Arabidopsis thaliana

Alignment Length:529 Identity:168/530 (32%)
Similarity:243/530 (46%) Gaps:109/530 (21%)


  Fly   735 RLPQAANAAILQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVS 799
            |..:..:||:....|..|||      :..|::|          .:||:.:.:...:.|.:.....
plant    19 RRRKGKHAAVDSAGESMESE------AIQEDLQ----------NLDVELKDVQGQISALIEHQDR 67

  Fly   800 QEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLE--- 861
            ..:..|.:||         .||.    ..||.|..:..||          .|..:...|..|   
plant    68 LYERKSELKT---------LLKA----LAASGSPVASSGG----------SSAIENWSETFEWDS 109

  Fly   862 -----ALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVIS 921
                 ..::||.:.:|..|...|...::|...||.::.|.||||||||||.|.    |..|||:|
plant   110 RADDVRFNVFGISKYRANQKEIINAIMTGRDVLVIMAAGGGKSLCYQLPAMLR----GGTTLVVS 170

  Fly   922 PLVSLMEDQVTGVPHF-LRAHCLHTNQTAPQRMKIQQMIANGEID--ILLVSPEAVVAGERATGF 983
            ||:||::|||.|:... :.|:.|.:.........:.:.:..||.|  ||.|:||.|...:|....
plant   171 PLLSLIQDQVMGLAALGISAYMLTSTSGKENEKFVYKALEKGEDDLKILYVTPEKVSKSKRFMSK 235

  Fly   984 GAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGV-RT------VLGLTATATLP 1041
            .........::...||||||.|||.|:|||.|        |||.: :|      ::.||||||..
plant   236 LEKCHNAGRLSLISIDEAHCCSQWGHDFRPDY--------KNLSILKTQFPKVPMVALTATATQK 292

  Fly  1042 TRVSIINHLGISDGERGIISDIPLPDNLVLSVSK---------DENRDAALLQLLNSERFEPCQS 1097
            .:..:|..|.|....: .:|.:..| ||..||.:         ||     :.:.:. |.:...:|
plant   293 VQNDLIEMLHIPKCVK-FVSSVNRP-NLFYSVREKSAVGKLVVDE-----IAEFIR-ESYSNNES 349

  Fly  1098 IIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSN 1162
            .|:||..|.|||:|||       |.||.           ...|:.|||.|.|:.|..|...:..|
plant   350 GIVYCFSRKECEQIAG-------DLRER-----------GISADYYHADMDANMREKVHMRWSKN 396

  Fly  1163 ELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGD---Q 1224
            :|:::|.|:||||||||||:|.|||:::.::.|:|.||.||||||||||.|.||.  :..|   |
plant   397 KLQVIVGTVAFGMGINKPDVRFVIHHSLSKSMETYYQESGRAGRDGLPSECILFF--RSADVPRQ 459

  Fly  1225 SELRRHVYS 1233
            |.:..:.||
plant   460 SSMVFYEYS 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 138/373 (37%)
DEAD 872..1039 CDD:278688 66/177 (37%)
HELICc 1073..1216 CDD:238034 60/152 (39%)
RECQL2NP_174421.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.