DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and AT1G27880

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_174109.2 Gene:AT1G27880 AraportID:AT1G27880 Length:911 Species:Arabidopsis thaliana

Alignment Length:1151 Identity:293/1152 (25%)
Similarity:465/1152 (40%) Gaps:296/1152 (26%)


  Fly   459 DFSADEDQDATYVPENKKKDKAKRKQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEKKPRNS 523
            ||  |.|.|.::|.....:|..    .:...:...|.....|.:.|.....:..||||...|..:
plant     2 DF--DSDSDGSHVSATPPRDSF----PSSPPQLQSPAKHVPPVSRKMTSSSSRSKPKAPTHPPPN 60

  Fly   524 KKAIAVEPAPDPEEDERQPLNPEDLKYVL-----ALEAGDITSVPRI-------NVQDLEE--AD 574
            ....|..|:|.|......||. .:|.:.:     |..:..::|..|:       :|:.|:.  .|
plant    61 PSQEAPVPSPYPPPPPPSPLF-TNLPFRICQSQPARFSSSVSSFSRLCSRASFTSVEKLKSDGVD 124

  Fly   575 ATAQRYIRTFAAGPNPGLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKK 639
            ...:..:....|.|.....:..|:..|...:...|.:..| :.|....|||.:|:..|   ||||
plant   125 FVPEPPLVEVIAPPKSVRRKPPNLITDTITSPPVKPMVFR-SNGNGEGNFVKLNLNGK---RGKK 185

  Fly   640 --------SVNFSKYKKQQWRHKKRVAALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDS 696
                    |.:.|.|..:..|:||:.|            ||                    .|:|
plant   186 FPSKYKGVSKSRSSYSFRGKRYKKKEA------------DG--------------------DGES 218

  Fly   697 LLPLSAQLEEDPSPFPTLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESS 761
            ||                                                     |.|.|.|:..
plant   219 LL-----------------------------------------------------EEESDLQKQI 230

  Fly   762 GDEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLD 826
            .||                         ....:|   |.|.|...:|                  
plant   231 EDE-------------------------ANGFIS---SVEDAILAVK------------------ 249

  Fly   827 TTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVT 891
            |.||..|.::      |.:|                  ::|:.:||.||.:||...|.|.|:::.
plant   250 TEASDENLTK------LLNL------------------VYGYDSFRDGQLQAIKMILGGSSTMLV 290

  Fly   892 LSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMKIQ 956
            |.||:|||||||:||.:    :..||||:|||||||.||:..:|..::...|.::|...:..:..
plant   291 LPTGAGKSLCYQIPAMI----LPGITLVVSPLVSLMIDQLKHLPSIIKGGLLSSSQRPEEATETL 351

  Fly   957 QMIANGEIDILLVSPEAVVAGERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMI-CK 1020
            :.:..|.|.:|.||||.::..|    |.::.|....::...:|||||||:|||||||||:.: ..
plant   352 RKLKEGIIKVLFVSPERLLNVE----FLSMFRMSLSVSLVVVDEAHCVSEWSHNFRPSYMRLKAS 412

  Fly  1021 VLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVS-KDENRDAALL 1084
            :|...|....:|.:|||||..|..::::.|.|.  ...:|....|.||..|||| ...||...||
plant   413 MLFSELKAECILAMTATATTMTLQAVMSSLEIP--STNLIQKSQLRDNFELSVSLSGANRMKDLL 475

  Fly  1085 QLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPA 1149
            .|:.|..::..:|||:||..:.|.:.|:.::|           |.       |..|:.||:|:||
plant   476 ILMESPPYKEIRSIIVYCKFQYETDMISKYLR-----------DN-------NINAKGYHSGLPA 522

  Fly  1150 SRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCH 1214
            ..|..:|::|.||::|:||||:|||||::|.|:.||||:::|.:.|.||||||||||||..|:||
plant   523 KDRVRIQESFCSNKIRVVVATVAFGMGLDKGDVGAVIHFSVPGSMEEYVQEIGRAGRDGRLSYCH 587

  Fly  1215 LFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIFVPCSCDKEASKRTALPIPLEGDGPRVHMCP 1279
            ||.|  .....:||...:|:.:|.:.:.|.|..:|  .:..|:..|..:|.|             
plant   588 LFYD--NDTYLKLRSLAHSDGVDEYAVGKFLTHVF--STETKQHEKICSLVI------------- 635

  Fly  1280 GHEIGFSVEKTVEMLDIPAENISTLLCYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKEC 1344
                    |...:..|:..|.:.|:|.::||.....:.:|....:...:      .:.|.:....
plant   636 --------ESASQKFDMKEEVMQTILTHLELGEVQYLRMLPQLNICCTL------NFHKSSPNTL 686

  Fly  1345 PPLAMAIALQIRDKTFKEDSNIIEF---------SVTDIAAGIG--WNSGVVKYQLKDLEWVKVN 1398
            ...:..:|..::....|:..::.:.         :.||:.|.|.  ...|.|.|:|||       
plant   687 AARSAIVAAILKKSHVKQGLHVFDIPAVASSICVATTDVLAEIQALKMKGEVTYELKD------- 744

  Fly  1399 GYPKRSPITVSFYDLGFRIKVPGDFTESEIDNALDTLYTRSVKQ-ERTQLIQLQYVAHGLAAVAY 1462
                    :...|.:   :|.|.:..      :|.:..|:.:.: |..::.:|..::.  ||||.
plant   745 --------SAFCYTI---LKSPKEIC------SLSSHLTKWLTEIESCKVRKLDIMSS--AAVAA 790

  Fly  1463 SSCGQCCNADFPQDRGEQLKAIVRNYFANDYPQDLELEIEPSNVPDEN---IIDDVHALINMYPD 1524
            .|............:...|::.:.:||..|...|     .||.. .:|   :..|:...:.....
plant   791 ISVSNTSELSSGAKQTRSLQSRIFDYFNGDEKCD-----SPSKA-TQNCAFLRADIKVFLQSNRQ 849

  Fly  1525 NTFTGRNIARIFHGIMSPNYPAVIWGRCKFWRAHVKVDFNRILHLA 1570
            ..||.|.||||.||:.||.:|..:|.:..||..::.|||..|:..|
plant   850 AKFTPRAIARIMHGVGSPAFPNSVWSKTHFWGRYMNVDFRVIMEAA 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 145/356 (41%)
DEAD 872..1039 CDD:278688 69/168 (41%)
HELICc 1073..1216 CDD:238034 63/144 (44%)
AT1G27880NP_174109.2 DEAD 271..413 CDD:278688 62/150 (41%)
AAA 284..412 CDD:214640 56/136 (41%)
HELICc 484..589 CDD:238034 55/123 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 315 1.000 Inparanoid score I708
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 1 1.000 T193259
orthoMCL 1 0.900 OOG5_131869
Panther 1 1.100 LDO PTHR13710
Phylome 1 0.910 0.667 Consistency score
65.970

Return to query results.
Submit another query.