DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQ4A

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_172562.2 Gene:RECQ4A AraportID:AT1G10930 Length:1188 Species:Arabidopsis thaliana

Alignment Length:1293 Identity:279/1294 (22%)
Similarity:464/1294 (36%) Gaps:382/1294 (30%)


  Fly   361 MNSSMNQKPDHLNHTPPASSQKSVAPKNKPPPSEQETDSDS------DSVVAESEEEQEPQE--- 416
            :||:...:    :|.|..  ||...|:.......:..:|.|      .|.|..:.|.|:|::   
plant     2 INSNQMSR----SHLPEV--QKPRGPQTNWSEHAKALESSSSVTKFLSSNVLYALESQKPRDMAA 60

  Fly   417 --------------YRQLSKRRKIVSTASG-----KVEVAAPVEIPNKVEPETETFAQENPDFSA 462
                          :.|:||..:.:|:.|.     :..|..|:::..            |..:||
plant    61 RSIAFPSVNVHTLAHPQISKAWRALSSLSVNNTYLRPGVTPPIDVGT------------NDSYSA 113

  Fly   463 DEDQDATYV--------PENKKKDKAKRKQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEKK 519
            .|...|..:        ...:....|......|:...:.|.:.|...     |:.|||.|:...:
plant   114 RERSTAKVISSTGGSVYSSTRPNLSAMNVSGTGRSFHSFPSSVPGDD-----KIVAEKFPRGNNE 173

  Fly   520 PRNS----------KKAIAVEPAPDPEEDERQ----PLNPEDLKYVLALEAGDITSVPRINVQDL 570
            .|.|          :|:......|..:.:.|:    .::.:|:     ||..|:..:    |.:.
plant   174 IRESEPSCTHLNGVEKSFGNSAFPAEQFESRKACLDDMDDDDI-----LENIDVDQI----VMEH 229

  Fly   571 EEADATAQRYIRTFAAGPNPGLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFV 635
            ..:.:|.|..:..|:....|         ||  |:|:|  |||.            .|:.     
plant   230 YHSTSTPQPSVSNFSLRTPP---------VD--RSASR--LEEE------------CNLP----- 264

  Fly   636 RGKKSVNFSKYKKQQWRHKKRVAALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPL 700
                                       |:: ...|..|:.... |.......:|.|   |.||.:
plant   265 ---------------------------PEL-CSNCSHGIKLGL-CPEASTHVEQMK---DVLLAI 297

  Fly   701 SAQLEEDPSPFPTLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDEL------NESEEDDQE 759
            |.:|.:|         |.:::..        .:.:|.|.......|..:|      .||::....
plant   298 SNELLDD---------ATDLSPD--------RVGQLRQERLRLKKQIQQLENHIRDKESQKSQFL 345

  Fly   760 SSGDEEVQQHPDP---NWSSDEMDVDFEA----------------LDAAVEAS----LSQPVSQE 801
            ||....:.|:..|   |:..|:...||.|                .|::....    .|.||.:|
plant   346 SSTATRIFQYETPKSTNYKMDQPQTDFRAHVSDQGRYACDSWNTPRDSSFSVDRYGLSSAPVERE 410

  Fly   802 KAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALH-- 864
            :....|                 :|.|.:..:..:..           .|.:......||..:  
plant   411 QYVPKI-----------------IDVTYTEGSNDKKW-----------SSREFPWTRKLEVNNKK 447

  Fly   865 MFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMED 929
            :||:.:||..|...|..|:||....|.:.||.||||.|||||.:    .|.|||||||||||::|
plant   448 VFGNHSFRPNQREIINATMSGSDVFVLMPTGGGKSLTYQLPALI----CGGITLVISPLVSLIQD 508

  Fly   930 QV-----TGVPHFLRAHCLHTNQTAPQRMKIQQMI--ANGEIDILLVSPEAVVAGERATGFGAIL 987
            |:     ..:|    |..|.......:::||.|.:  .:.:..:|.|:||.|...:      ::|
plant   509 QIMNLLQANIP----AASLSAGMEWAEQLKIFQELNSEHSKYKLLYVTPEKVAKSD------SLL 563

  Fly   988 RQLPP------IAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSI 1046
            |.|..      :|...||||||||||.|:|||.|..: .:|::......||.||||||...:..:
plant   564 RHLENLNSRGLLARFVIDEAHCVSQWGHDFRPDYQSL-GILKQKFPNIPVLALTATATASVKEDV 627

  Fly  1047 INHLGI--------SDGERGI-ISDIPLPDNLVLSVSKDENRDAALLQLLNSERFEPCQSIIIYC 1102
            :..||:        |.....: .|.:|.....:..:.|          .:....|:.|.  ||||
plant   628 VQALGLVNCVVFRQSFNRPNLWYSVVPKTKKCLEDIDK----------FIKENHFDECG--IIYC 680

  Fly  1103 TRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIV 1167
            ..|.:||::                  :::.:....:|..||..|...:|..:|..:..:|:.|:
plant   681 LSRMDCEKV------------------SERLQEFGHKAAFYHGSMEPEQRAFIQTQWSKDEINII 727

  Fly  1168 VATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVY 1232
            .||:||||||||||:|.|||:::|::.|.|.||.|||||||..|.|.|:...  ||...::..:.
plant   728 CATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYGY--GDYIRVKHMIS 790

  Fly  1233 SNSIDRHVIRKLLQKIFVPCSCDKEASKRTALPIPLEGDGPRVHMCPGHEIGFSVEKTVEMLDIP 1297
            ...:|:                                 .|   |..|:.   .|..:..:|:..
plant   791 QGGVDQ---------------------------------SP---MATGYN---RVASSGRLLETN 816

  Fly  1298 AENISTLLCYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIRDKTFKE 1362
            .||:..::.|.|.:.. |...|...::..|..|       .:..|.|.....:.:|..:|.|   
plant   817 TENLLRMVRYCENEVE-CRRFLQLVHLGEKFDS-------TNCKKTCDNCCSSQSLIDKDVT--- 870

  Fly  1363 DSNIIEFSVTDIAAGIG--WNSG----VVKYQLKDLEWVKVNGYPKRSPITVSFYDLGFRIKVPG 1421
               :|...:.::....|  ::|.    |.:..|..:  ||     |....|:.|:..|..:    
plant   871 ---LITRQLVELVKQTGERFSSAHILEVYRGSLNQM--VK-----KHRHETLQFHGAGKHL---- 921

  Fly  1422 DFTESEIDNALDTLYTRSVKQERTQ-------LIQLQYVAHGLAAVAYSSCGQCCNADFPQD--- 1476
              ::.|:...|..|.|..:..|..:       :..|..|.:..|.:.:|. .|.....||..   
plant   922 --SKIEVSRILHYLVTEDILVEDVRKSDMYGSVSSLLQVNNAKATILFSG-SQTIVMKFPSSVKV 983

  Fly  1477 --RGEQLKAIVRNYFANDYPQDLELEIEPSNVPDENIIDDVH--------ALINMYPD 1524
              ..:|.....:....::....|.|..|.:...|.|:..:::        ||:...||
plant   984 LKPSKQGATAAKGPLTSEKQSTLPLTTEDAPPKDVNLSANMYTALRKLRTALVKEAPD 1041

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 128/378 (34%)
DEAD 872..1039 CDD:278688 70/180 (39%)
HELICc 1073..1216 CDD:238034 49/143 (34%)
RECQ4ANP_172562.2 PLN03137 1..1188 CDD:215597 279/1294 (22%)
DEAD 455..625 CDD:278688 71/185 (38%)
HELICc 650..776 CDD:238034 51/156 (33%)
RecQ_Zn_bind 781..858 CDD:292742 17/124 (14%)
RQC 868..966 CDD:214936 21/117 (18%)
Sec_Non_Glob 955..>1023 CDD:275213 13/69 (19%)
HRDC 1025..1090 CDD:278967 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.