DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQSIM

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001330792.1 Gene:RECQSIM AraportID:AT5G27680 Length:858 Species:Arabidopsis thaliana

Alignment Length:1008 Identity:226/1009 (22%)
Similarity:359/1009 (36%) Gaps:374/1009 (37%)


  Fly   667 MGG--CDGGVLTCF----QCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSPFPTLAEAQEMASQGA 725
            :||  ||..|....    :.||....:..|....:.:|...|.    ||.|    .:.|...|.:
plant    29 VGGKSCDDAVEYILKGNHRTGGFKPASLLCSSGSNKILGKRAM----PSSF----SSSESKRQSS 85

  Fly   726 VVAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEVQQHPDPNWSSDEMDVDFEALDAAV 790
            ::.|.|::::..:       :||.....|.|.|.    |.|.:|      |:|           |
plant    86 LLDHFRSVNQNKK-------KGDTFGTVEVDSQL----ETVSEH------SEE-----------V 122

  Fly   791 EASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDLLPDGSVQDT 855
            ..||: ||..|.:.          .||..|.....:.::|...|                     
plant   123 RKSLA-PVFMESSC----------FPEGQLLNGCSEASSSWEKR--------------------- 155

  Fly   856 TPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVI 920
            ...:|.  :.||.::.|..|..|:...::....||..:||||||||:|:||.|    .|.:.:||
plant   156 VNSILR--NRFGISSLRSFQREALSTWVAHKDCLVLAATGSGKSLCFQIPALL----TGKVVVVI 214

  Fly   921 SPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMKIQQ-MIANGEID-------------ILLVSP 971
            |||:|||.||           ||..:     |.|:.. .:.:|::|             |:.|.|
plant   215 SPLISLMHDQ-----------CLKLS-----RHKVSACFLGSGQLDNCIEEKAMQGMYQIIYVCP 263

  Fly   972 EAVVAGERATGFGAILRQLPP---------IAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLG 1027
            |.||            |.:.|         ||...||||||||:|.|:|||.|..: .|||:|..
plant   264 ETVV------------RLIKPLQKLAKTHGIALFAIDEAHCVSKWGHDFRPHYRKL-SVLRENFC 315

  Fly  1028 VRT---------VLGLTATATLPTRVSIINHLGISDGERGIISDIPLPD---------------- 1067
            ...         ::.||||||:..:..|:..|.:|...:.:::....|:                
plant   316 ASNLEFLEYDVPIMALTATATVNVQEDILESLHLSKETKIVLTSFFRPNLQFSVKHSRTKFASSY 380

  Fly  1068 -----NLVLSVSKDENRDAALLQLLNSER-----FEPCQSIIIYCTRRDE--------------- 1107
                 |||...|:.:|.....|.:::.|.     |....|..|:.|..||               
plant   381 AKDFQNLVDLYSEKKNSTGKKLAVISRESEEQTDFGSHDSENIHETDYDEDEEDQENSLAKKNSS 445

  Fly  1108 -----------------------------------CE------------RIAGFIRTCVQDRREP 1125
                                               ||            .:.|.....|..|:| 
plant   446 NGKELSEAYLEDETDIFQSVDDWDVACGEFCAMPSCELLEIPVPSEKQKDLEGLTIIYVPTRKE- 509

  Fly  1126 TQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNM 1190
            :.:..|....|..:|..|:|.:|....|.|.:.|..|:|::|||||||||||:|.::|.:|||..
plant   510 SVNIAKYLCGVGLKAAAYNASLPKKHLRQVHQDFHDNKLQVVVATIAFGMGIDKKNVRKIIHYGW 574

  Fly  1191 PRNFESYVQEIGRAGRDGLPSHCHLFLD----------AKGGDQSELRRHVYSNSIDRHVIR--K 1243
            .::.|:|.||.|||||||..:.|.|:.|          .:..:|:|....:.|:.. |:.:.  :
plant   575 LQSLEAYYQEAGRAGRDGELAECVLYADLSRAPTLLPSRRSKEQTEQAYKMLSDCF-RYGMNTSQ 638

  Fly  1244 LLQKIFVPCSCDKEASKRTALPIPLEGDGPRVHMCPGHEIGFSVEKTVEMLDIPAENISTLL--- 1305
            ...||.|....::.:||:                |...::  ..|...|::|:..|  :.||   
plant   639 CRAKILVEYFGEEFSSKK----------------CNSCDV--CTEGPPELVDVREE--ANLLFQV 683

  Fly  1306 ---CYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIRDKTFKEDSNII 1367
               .::::|.       .|.:...:....|..|..|.:.|  |.|...|: ::|::..|      
plant   684 ITAFHLQVDN-------DSEHAPYEDYGLGNSKQNKLSHK--PNLLFFIS-KLREQCEK------ 732

  Fly  1368 EFSVTDIAAGIGWNSGVVKYQLKDLEWVKVNGYPKRSPITVSFYDLGFRIKVPGDFTESEIDNAL 1432
             |..||..    |..|:.:.       ::..||.|                        |:||  
plant   733 -FKETDCL----WWKGLARI-------MEAEGYIK------------------------EMDN-- 759

  Fly  1433 DTLYTRSVKQERTQLIQLQYVAHGLAAVAYSSCGQCCNADFPQDRG-EQLKAIVRNYFANDYPQD 1496
                    |..|.::..:|                      |.::| :||          |:..|
plant   760 --------KDRRVEIKFIQ----------------------PTEKGKKQL----------DFQDD 784

  Fly  1497 LELEIEPSNVPDENIIDDVHALINMYPDNTFTG 1529
            ..|.:.|          :...|:::..|.|::|
plant   785 KPLYVYP----------EADMLLSLKQDRTYSG 807

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 133/474 (28%)
DEAD 872..1039 CDD:278688 67/199 (34%)
HELICc 1073..1216 CDD:238034 56/210 (27%)
RECQSIMNP_001330792.1 UBA_like_SF 8..42 CDD:304366 5/13 (38%)
DEXDc 162..355 CDD:214692 73/226 (32%)
DEAD 170..341 CDD:278688 68/204 (33%)
HELICc 486..600 CDD:238034 44/115 (38%)
RecQ_Zn_bind 612..663 CDD:292742 10/70 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.