DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RecQl3

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_195299.2 Gene:RecQl3 AraportID:AT4G35740 Length:713 Species:Arabidopsis thaliana

Alignment Length:413 Identity:144/414 (35%)
Similarity:205/414 (50%) Gaps:67/414 (16%)


  Fly   847 LPDGSVQDTTPEVL--EAL------HMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQ 903
            ||..:||.:...|.  |||      | |||.:||..|..||...:||......:.||.|||:|||
plant     6 LPVQNVQSSDKNVAGKEALVKLLRWH-FGHADFRGKQLEAIQAVVSGRDCFCLMPTGGGKSICYQ 69

  Fly   904 LPAYLYSRKVGAITLVISPLVSLMEDQVTGVPH-FLRAHCLHTNQTAPQRMKIQQMIANGE--ID 965
            :||.   .|.| |.||:|||::|||:||..:.. .:.|..|.:.|....:.||.:.:.:|:  :.
plant    70 IPAL---AKPG-IVLVVSPLIALMENQVMALKEKGIAAEYLSSTQATHVKNKIHEDLDSGKPSVR 130

  Fly   966 ILLVSPEAVVAGERATGFGAILRQLPP---IAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLG 1027
            :|.|:||.:.    ..||...||:|..   :....||||||:|.|.|:|||||..: ..||.:|.
plant   131 LLYVTPELIA----TKGFMLKLRKLHSRGLLNLIAIDEAHCISSWGHDFRPSYRQL-STLRDSLA 190

  Fly  1028 VRTVLGLTATATLPTRVSIINHLGI--------SDGERGIISDIPLPDNLVLSVSKDENRDAALL 1084
            ...||.|||||....:..:|:.|.:        |.....|..::...|.|       :|....|.
plant   191 DVPVLALTATAAPKVQKDVIDSLNLRNPLVLKSSFNRPNIFYEVRYKDLL-------DNAYTDLG 248

  Fly  1085 QLLNSERFEPCQSI--IIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGM 1147
            .||.|     |.:|  ||||..|..|:                  |.:.....:...:..||||:
plant   249 NLLKS-----CGNICAIIYCLERTTCD------------------DLSVHLSSIGISSAAYHAGL 290

  Fly  1148 PASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSH 1212
            .:..|.||...::|::.:|:|||:||||||:|.|:|.|.|:|:|::.||:.||.||||||.|||.
plant   291 NSKMRSTVLDDWLSSKKQIIVATVAFGMGIDKKDVRMVCHFNIPKSMESFYQESGRAGRDQLPSR 355

  Fly  1213 CHLFLDAKGGDQSELRRHVYSNS 1235
            ..|:.   |.|..:...::..||
plant   356 SVLYY---GVDDRKKMEYLLRNS 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 132/370 (36%)
DEAD 872..1039 CDD:278688 68/173 (39%)
HELICc 1073..1216 CDD:238034 53/145 (37%)
RecQl3NP_195299.2 DEXDc 32..235 CDD:214692 76/212 (36%)
DEAD 41..207 CDD:278688 67/175 (38%)
HELICc 229..359 CDD:238034 56/160 (35%)
RecQ_Zn_bind 364..427 CDD:292742 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.