DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQI1

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_187225.2 Gene:RECQI1 AraportID:AT3G05740 Length:606 Species:Arabidopsis thaliana

Alignment Length:671 Identity:197/672 (29%)
Similarity:291/672 (43%) Gaps:179/672 (27%)


  Fly   665 MDMGGCDG-GVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSPFPTLAEAQEMASQGAVVA 728
            :|:.|.|| ..:|...|             ||..|...|..||....:..: :|.|..:||    
plant    35 VDLYGDDGRDFITVELC-------------GDDFLAALADFEEGTEEWDDI-QAIESEAQG---- 81

  Fly   729 HSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEV-QQHPDP---------NWSSDEMDVD- 782
                  .|.:..:.:....|...::::||.:|..:..| :..|:|         :.|||..||: 
plant    82 ------NLAEMFDKSTNPSDNGFDTDDDDDDSRVEVHVIEDSPEPKKKPEIVELDSSSDLEDVET 140

  Fly   783 -FEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKPLYDL 846
             |:....:...|.|...|.|.:.|.|               :|...:...||:...   .|.|:.
plant   141 RFKVPRRSQTCSRSMDYSMEDSVSTI---------------SGRKPSVQISNKDHE---TPSYEE 187

  Fly   847 LPDGSVQDTTPEVLEALH-----MFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPA 906
            |          :.|:.|.     :||:..||..|.:|...::......|.:.||.||||||||||
plant   188 L----------QALDDLEFANLVIFGNKVFRPLQHQACRASMERKDCFVLMPTGGGKSLCYQLPA 242

  Fly   907 YLYSRKVGAITLVISPLVSLMEDQVT------GVPHFLRAHCLHTNQTAPQRMKIQQMIA--NGE 963
            .|   |.| :|:|||||:||::||:.      |:|    |..|::.||:.|...:.|.:.  |..
plant   243 TL---KAG-VTIVISPLLSLIQDQIVALNLKFGIP----ATFLNSQQTSSQAAAVLQELRRDNPS 299

  Fly   964 IDILLVSPEAVVAGERATGFGAILRQLPP---IAFACIDEAHCVSQWSHNFRPSYLMI-CKVLRK 1024
            ..:|.|:||. :||  ::.|...||.|..   :|...:|||||||||.|:|||.|..: |  |::
plant   300 CKLLYVTPEK-IAG--SSSFLETLRCLDRKGLLAGFVVDEAHCVSQWGHDFRPDYRELGC--LKQ 359

  Fly  1025 NLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVSKDE-----------N 1078
            |.....|:.||||||    .|:.         :.::..:.:|...||.:|.|.           .
plant   360 NFPRVPVMALTATAT----ESVC---------QDVLKSLRIPRAPVLKMSFDRINLKYEVIVKTK 411

  Fly  1079 RDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPY 1143
            .....||.|..:||:. ||.|:||..:.||..:|.|:            ::..|.|.|.     |
plant   412 EPLKQLQELLRDRFKD-QSGIVYCLSKSECVDVAKFL------------NEKCKVKTVY-----Y 458

  Fly  1144 HAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDG 1208
            |||:||.:|..||:.:.:.|:|||.|||||||||:|.|:|.|||..:.:..|||.||.|||||||
plant   459 HAGVPAKQRVDVQRKWQTGEVRIVCATIAFGMGIDKADVRFVIHNTLSKAVESYYQESGRAGRDG 523

  Fly  1209 LPSHCHLFLDAK----------GGD-----------------------QSELRRHV----YSNSI 1236
            |.:.|......|          .|.                       ::|.||.:    :..|.
plant   524 LQAQCICLYQKKDFSRVVCMLRNGQGRNMDRFKSAMAQAKKMQQYCELKTECRRQMLLEYFGESF 588

  Fly  1237 DRHVIRKLLQKIFVPC-SCDK 1256
            ||.:.:..|.    || :|::
plant   589 DRMICKSSLN----PCDNCER 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 141/382 (37%)
DEAD 872..1039 CDD:278688 72/179 (40%)
HELICc 1073..1216 CDD:238034 61/154 (40%)
RECQI1NP_187225.2 DEXDc 202..407 CDD:214692 82/231 (35%)
DEAD 208..377 CDD:278688 74/186 (40%)
HELICc 401..529 CDD:238034 59/146 (40%)
RecQ_Zn_bind 536..603 CDD:292742 10/71 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.