DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and Recql4

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_006521609.1 Gene:Recql4 MGIID:1931028 Length:1267 Species:Mus musculus

Alignment Length:1659 Identity:472/1660 (28%)
Similarity:683/1660 (41%) Gaps:496/1660 (30%)


  Fly    14 KLRVKVWEKDFKKKNGRVPSKYDIRDASQEIRDSYKMYYKLKTSFLEETLNDVLSEDGYDILEMS 78
            :.|::.||:.|.:.:||.|:|.|:..|.:|.|..|:.|..||.:..:       ::|.:.:||.|
Mouse     8 RARLQEWERAFARLHGRRPAKGDVEAAPEETRALYREYRNLKQAVRQ-------ADDRHRVLEQS 65

  Fly    79 QASDFGVSMLDQDVSLNEGPQLPLDISALVGPQSSGNLEEIPQSVEGSFSNLIDLPNRQVLTNLV 143
            .|                                                               
Mouse    66 LA--------------------------------------------------------------- 67

  Fly   144 NRDENHVIRKFEAVEELPINQNAWGLNVSKKPPAPPQPVEAS---KSAPGHGKQPKAGASLK--- 202
                       ||.||.. ..:.||.::|:......|.:...   .|...:||:.|  |:||   
Mouse    68 -----------EAAEEAQ-EPSCWGPHLSRAATQNTQSMPKQSLLSSVQDYGKRLK--ANLKNTT 118

  Fly   203 ---PSLSAKLFQSSRGFAK-RNPRKPLSRCVS--SSSSTTSLSSVPTDHHEELLDFETILIRKAQ 261
               |:.|.||....|..:. ..||.|.|:..|  ...:..:|..||                   
Mouse   119 QTGPTQSRKLQLQKRSLSTVPAPRPPGSKTESPCPDEADDALPRVP------------------- 164

  Fly   262 EYKEKQQAIANNPMLASEHSKESIKTLVDDGWLRR--NTKENTLDEEVPFAEANNNSGTSKKTNF 324
               |.:..:.....|.|..|:.  .|.:|.|||.|  |...:.|  |||                
Mouse   165 ---EPRPRLGQLQQLRSSLSRR--LTSLDPGWLERCHNRVSDLL--EVP---------------- 206

  Fly   325 GLANLDLSKLKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHTPPASSQKSVAPKNK 389
            |...|||                                                          
Mouse   207 GACGLDL---------------------------------------------------------- 213

  Fly   390 PPPSEQETDSDSDSVVAESEEEQEPQEYRQLSKRRKIVSTASGKVEVAAPVEIPNKVEPET-ETF 453
                              |.||.:||              .||||.:|.| :|.::|..:: |..
Mouse   214 ------------------SAEESQPQ--------------MSGKVNIADP-DIQSEVSVQSPEAI 245

  Fly   454 AQENPDFSADEDQDATYVPENKKKDKAKRKQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEK 518
            ||          |.|..:.::.|...:|.:               |.|..:|.:..|:.:|.:..
Mouse   246 AQ----------QPAQVLSQSPKSINSKGR---------------KRKWNEKGEDFAQDQPSSGA 285

  Fly   519 KPRNSKKAIAVEPAPDPEEDER----QPLNPEDLKYVLALEAGDITSVPRINVQDLEEADATAQR 579
            .|.:......|.....|.|..:    ||.|..                   |....|:|..|...
Mouse   286 GPLSEGARATVHGQDPPGEPTQVNVPQPCNSS-------------------NQARTEKAKGTTHL 331

  Fly   580 YIRTFAAGPNP-GLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNF 643
            :     |.|.| .|..|:.||::.|                 |:.||.:...:.:.:|       
Mouse   332 H-----ASPRPASLDRGNYIRLNMK-----------------NKRFVRVGANRGRLLR------- 367

  Fly   644 SKYKKQQWRHKKRVAALSGP---DMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLE 705
            .:..||:|:.|:.....|||   |.|         |||:||..||:|.||...|.:|........
Mouse   368 KQVWKQKWKKKQAAFGGSGPRATDKD---------TCFRCGQFGHWASQCSQPGPTLTVQEEGDR 423

  Fly   706 EDPSPFPTLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEVQQHP 770
            :|..|..||.|..:..  |....|                     :.:.|:.|.::.:.:|...|
Mouse   424 DDKQPISTLEEVAQRT--GTASCH---------------------HSAGEETQPAAPELQVPHCP 465

  Fly   771 DPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRS 835
            .|                                                               
Mouse   466 TP--------------------------------------------------------------- 467

  Fly   836 QHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSGKSL 900
                :.|||...|.|.|.:|..||.:||...|:..||.||:|||||.|||:|:|:.|.||:||||
Mouse   468 ----MSPLYPPGPLGQVAETPAEVFQALERLGYRAFRPGQERAIMRILSGISTLLVLPTGAGKSL 528

  Fly   901 CYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMKIQQMIANGEID 965
            ||||||.||:::...:|||:|||:|||:|||:.:|..|:|.|||:..|..||..:.:.:...::.
Mouse   529 CYQLPALLYAQRSPCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTKKQRESVLKKVRAAQVH 593

  Fly   966 ILLVSPEAVV-AGERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVR 1029
            :|:|||||:| .|.|..|......||||||||||||.||:|||||||||.||.:|||||:::|||
Mouse   594 VLIVSPEALVGCGARGPGSLPQAAQLPPIAFACIDEVHCLSQWSHNFRPCYLRVCKVLREHMGVR 658

  Fly  1030 TVLGLTATATLPTRVSIINHLGISDGERGIISDIPLPDNLVLSVSKDENRDAALLQLLNSERFEP 1094
            ..||||||||..|...:..||||: ||..:.....:|.||.||||.|.:.|.||:.||..:||..
Mouse   659 CFLGLTATATRSTARDVAQHLGIA-GEFELSGSANIPANLHLSVSMDRDSDQALVTLLQGDRFRT 722

  Fly  1095 CQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAF 1159
            ..|:|||||||.:.||:|..:|||:    ....|...:.......||.|||||.:..||.||:||
Mouse   723 LDSVIIYCTRRKDTERVAALLRTCL----SMVGDSRPRGCGPEAIAEAYHAGMSSQERRRVQQAF 783

  Fly  1160 MSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFL------- 1217
            |...||:||||:|||||:::||:|||:|..:|.:||||||.||||||||.|:|||||:       
Mouse   784 MRGHLRMVVATVAFGMGLDRPDVRAVLHLGLPPSFESYVQAIGRAGRDGKPAHCHLFMHPQVGSP 848

  Fly  1218 -------------------------------------------DAKGGDQSELRRHVYSNSIDRH 1239
                                                       ..:|.|..|||||.:::|.|..
Mouse   849 ISPDQDRPRGSTIPRPLQPQLLSCLPVSCRPGPKCGSSVHMTVPMQGEDLWELRRHAHADSTDFL 913

  Fly  1240 VIRKLLQKIFVPCSCDKEASKRTALPIPLEGDGPRVH-----MCPGHEIGFSVEKTVEMLDIPAE 1299
            .:::|:|::|.||:|.:....:::.....|..|.:.:     .|.|||....|:.||:.||:..|
Mouse   914 AVKRLVQRVFPPCTCSQRPVSKSSPEEVKEHSGQQTYPVLGQACLGHERALPVQSTVQALDMTEE 978

  Fly  1300 NISTLLCYMELDPRWCISVLSSAYVMAKVISYGGPKYLKHAAKECPPLAMAIALQIR--DKTFKE 1362
            .|.|||||:||.||..:.:|...|....:...||...|:..|..|||||   |.|.:  .|...:
Mouse   979 AIETLLCYLELHPRHWLELLPWTYAQCHLHCLGGSAQLQALAHRCPPLA---ACQAKWPPKDTSQ 1040

  Fly  1363 DSNIIEFSVTDIAAGIGWNSGVVKYQLKDLEWVKVNGYPKR-----SPITVSFYDLGFRIKVPGD 1422
            ..:.:||.|.::|..:||....|:..|..|:|   :..||:     :.:.|.|.:|.|.:...||
Mouse  1041 GRSSLEFGVVELADSMGWKLASVRQALHQLKW---DPEPKKGAAQGTGVLVKFSELAFHLHSRGD 1102

  Fly  1423 FTESEIDNALDTLYTRSVKQERTQLIQLQYVAHGLAAVAYSSCGQCCNADFPQDRGEQLKAIVRN 1487
            .|:.|.|...|.||.|...:|...|..|..::....:||:.|||.|.... .::...|:|.:|..
Mouse  1103 LTDEEKDQICDFLYNRVQAREHKALAHLHQMSKAFRSVAFPSCGPCLEQS-NEEHSNQVKTLVSY 1166

  Fly  1488 YFANDYPQDLELEIEPSNVP--------DENIIDDVHALINMYPDNTFTGRNIARIFHGIMSPNY 1544
            ||..:..::..:.......|        ::.|..||..|:::.|:..|:||.:|||||||.||.|
Mouse  1167 YFEEEEEEEETMTDTQGPKPGQTQLQDWEDQIRRDVRQLLSLRPEERFSGRAVARIFHGIASPCY 1231

  Fly  1545 PAVIWG-RCKFWRAHVKVDFNRILHLANMAIIKR 1577
            ||.::| ..:|||.::.:||:.::|||...::.|
Mouse  1232 PAQVYGLDRRFWRKYLHLDFHALMHLATEELLLR 1265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 191/405 (47%)
DEAD 872..1039 CDD:278688 99/168 (59%)
HELICc 1073..1216 CDD:238034 76/143 (53%)
Recql4XP_006521609.1 ZnF_C2HC 394..408 CDD:197667 9/14 (64%)
DEXDc 491..679 CDD:214692 105/188 (56%)
DEAD 500..673 CDD:278688 101/173 (58%)
HELICc 708..840 CDD:238034 73/136 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338390804
eggNOG 1 0.900 E1_COG0514
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 633 1.000 Inparanoid score I831
Isobase 1 0.950 0 Normalized mean entropy S4803
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 1 1.000 FOG0004747
OrthoInspector 1 1.000 T1084869
orthoMCL 1 0.900 OOG5_131869
Panther 1 1.100 LDO PTHR13710
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5620
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.