DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and recql4

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_001072882.1 Gene:recql4 XenbaseID:XB-GENE-997814 Length:1520 Species:Xenopus tropicalis

Alignment Length:1764 Identity:533/1765 (30%)
Similarity:801/1765 (45%) Gaps:444/1765 (25%)


  Fly     9 KYQKYKLRVKVWEKDFKKKNGRVPSKYDIRDASQEIRDSYKMYYKLKTSFLEETLNDVLSEDGYD 73
            :|.:.|:.:|.||..|.:::.|.|:|.|:.:||.|.::.||.|..||...|:.:...|.:.....
 Frog     3 RYNQVKVLLKNWETAFLQEHKRRPNKTDVENASNETQELYKEYRSLKQGQLDVSTESVFTPKSGQ 67

  Fly    74 IL--EMSQASDFGVSMLDQDVSLNEGPQL---------------PLDISA-LVGPQSSGNL---- 116
            :.  .:::::|   :..|.:.|.:.|..|               .|..|| ..|.:...||    
 Frog    68 VASPRLARSAD---AAGDSEGSASWGSHLNRACVTPKLTPKERDSLKASAQFYGMKLKANLGGAS 129

  Fly   117 EEIPQSVEGSFSNLIDLP-NRQVLTNLVNRDENHV---------IRKFEAVEELPINQNAWGLNV 171
            :|.|.|::.||:     | :|..:.:...:..||:         |...|.:::.|...:....::
 Frog   130 KERPVSLKKSFT-----PRSRPAIGSPDVKTRNHLAFPKPPGTPISPPELLQDTPSEPSDTSSHI 189

  Fly   172 SKKPPAPPQPVEASKSAPG------HGKQPKAGASLKPSLSAKLFQSSRGFAKRNPRKPL----- 225
            |.|.| ||:|. .:.||.|      |..|...|..: .||:.:..|...   .||..:|:     
 Frog   190 SLKEP-PPKPA-WNPSALGQPIKKQHQLQAMVGQRM-ASLNQEWLQRCE---LRNGAEPMEVTAA 248

  Fly   226 -------SRCVSSSSSTTSLSSVPTDHHEELLDFETILIRKAQEYKEKQQAIANNPMLASEHSKE 283
                   .:|.|:.......:...||.|                      ..:||...|  ||..
 Frog   249 EQRNVNREQCDSTWEPLAEGAIESTDLH----------------------ITSNNDEFA--HSVT 289

  Fly   284 SIKTLVDDGWLRRNTKENTLDEEVPFAEANNNSGTSKKTNFGLANLDLSKLKPTVKEEKVLQAKP 348
            |....|                 :.|....:....|.........||.|..||   ::|.::. |
 Frog   290 SPTHSV-----------------LAFTPGPSQHAASPSLPLTFGRLDKSPEKP---KQKAVET-P 333

  Fly   349 DQMAIIQELQTDMNSSMNQK-----PDHLNHTPPASSQKSVAPKNKPPPSEQETDSDSDSVVAES 408
            .:.:|::...||..||.|::     ||.             .|..:..|..|....:|.:.:||:
 Frog   334 GRNSIVRSRVTDSVSSRNKREGVWDPDQ-------------QPLERKFPVRQRICVESKASLAEA 385

  Fly   409 EEEQEPQEYRQLSKRRKIVSTASGKVEVAAPVEIPNKVEPETETFAQENPDFSADEDQDATYVPE 473
                ....:.||..:..:.:.:....::.....:.|:..|.     |::|       |:...:|:
 Frog   386 ----GMGAHNQLDSKGPMSNGSKQLQDIDVGQVMKNRTRPR-----QQSP-------QEVDGMPQ 434

  Fly   474 ------------NKKKDKAKRKQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEKKPRNSKKA 526
                        :|.|.|.::::.:.:|..    .|..||..||.:       |.:..|.|.:|:
 Frog   435 ETIAGGEASAILSKGKRKKRQREISAEQDA----VEESPKVSKKRR-------KTKMSPDNGEKS 488

  Fly   527 IAV-----------EPAPDP------EEDERQPLNPEDLKYVLALEAGDITSVPRINVQDLEEAD 574
            ..|           :.:.||      .|...:|:: |||                  ..:|||  
 Frog   489 SPVQNRRKRGARRNDSSDDPSMESPASEQGAKPVS-EDL------------------FGELEE-- 532

  Fly   575 ATAQRYIRTFAAGPNPGLSEGSNIRVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKK 639
            .||||                  |.|...:|....:::        :||||.||::||..|: ..
 Frog   533 ETAQR------------------ISVKTAKATRMPQIK--------SENFVRINLKKKSHVK-SF 570

  Fly   640 SVNFSKYKKQQWRHKKRVAALSGPDMDMGG--CDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSA 702
            ::|..:.:||.|:.|.:   ..|.....||  .:.|..|||:|||:||:|.||    ...:|:..
 Frog   571 ALNGQRLRKQMWKQKWQ---KKGEQFGGGGKHFNRGGDTCFRCGGIGHWASQC----PGSVPVVR 628

  Fly   703 Q-----LEEDPSPFPTLAEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESSG 762
            |     .||:....|||.:...|.:           ::| |:.:|.:..|               
 Frog   629 QEVVEIEEEEEVSLPTLEDVARMTN-----------TQL-QSTSAEVPSG--------------- 666

  Fly   763 DEEVQQHPDPNWSSDEMDVDFEALDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDT 827
                       |....:     |....|.|....|    :..||::.                  
 Frog   667 -----------WCQGPV-----ATLNVVRAVYEPP----EPPSPMQA------------------ 693

  Fly   828 TASSSNRSQHGGVKPLYDLLPDGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTL 892
                           ||:|.|||.|::|..||.:.|...|:::||.||::|:||.||||||||.|
 Frog   694 ---------------LYELEPDGKVKETPAEVYDTLSELGYSSFRPGQEQAVMRILSGLSSLVIL 743

  Fly   893 STGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMKIQQ 957
            |||.|||||||||||:|:::...||||||||||||:|||:|:|..|:|.|:|:|.|..||....:
 Frog   744 STGMGKSLCYQLPAYMYAKRSRCITLVISPLVSLMDDQVSGLPPKLKAVCIHSNMTRTQRETAIE 808

  Fly   958 MIANGEIDILLVSPEAVVAGERATGFGAI--LRQLPPIAFACIDEAHCVSQWSHNFRPSYLMICK 1020
            .:..|::.:||:||||:|.|.: :|...:  ..||||:||||||||||||:|||||||.||.:||
 Frog   809 KVKQGKVHVLLLSPEALVGGGQ-SGSSCLPPAEQLPPVAFACIDEAHCVSEWSHNFRPCYLRLCK 872

  Fly  1021 VLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGI-ISDIPLPDNLVLSVSKDENRDAALL 1084
            |||:.|||..:||||||||..|...:..|||:|. |.|| :....:|.||.||||.|.|||.||:
 Frog   873 VLRERLGVNCLLGLTATATRATAEDVARHLGVSQ-EGGIPVRMASVPPNLHLSVSMDRNRDQALV 936

  Fly  1085 QLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCV----------QDRREPTQDQTKK------- 1132
            .||..|||....|:|:|||||:|.:||:..:||.:          |::.|.|....||       
 Frog   937 TLLKGERFGCLDSVIVYCTRREETQRISALLRTSLQGVTVSNLNSQEQEEATVSDRKKAQALKKI 1001

  Fly  1133 RKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESY 1197
            |:.:.|.||.|||||.|:.||.||..||..:||:||||:|||||::|.|:|.:||||||:|||||
 Frog  1002 RRPLKWIAESYHAGMSAAERRRVQNNFMCGQLRLVVATVAFGMGLDKSDVRGIIHYNMPKNFESY 1066

  Fly  1198 VQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIFVPCS--------- 1253
            |||||||||||..:.||||||.:..|..|||||:||:|:|...:::|:||:|..|.         
 Frog  1067 VQEIGRAGRDGKDAQCHLFLDPEEHDMDELRRHIYSDSVDCITVKRLVQKVFPKCKCRDLEREQQ 1131

  Fly  1254 --------------------------------------CDKEASKRTAL---------PI---PL 1268
                                                  ||..:|.|..:         |:   |:
 Frog  1132 ALTNAGEVEDSELLEFLAQSGEEQDGMCDTPSSGTDPVCDTPSSGRDPVCDTPVSGRDPVCDTPI 1196

  Fly  1269 EGDGPRV---HMCPGHEIGFSVEKTVEMLDIPAENISTLLCYMELDPRWCISVLSSAYVMAKVIS 1330
            .|..|.:   .:|..||....:|:||:.|||..|.|.|||||:||.|...:..:.......:|:.
 Frog  1197 IGRDPSMRTPRLCHRHERAIPIEETVQGLDIREEAIETLLCYLELHPSHWLEQMHPTLSHCRVVC 1261

  Fly  1331 YGGPKYLKHAAKECPPLAMAIALQIRDKTFKEDS---NIIEFSVTDIAAGIGWNSGVVKYQLKDL 1392
            |.||:.|:..|..|||:|:.:|   |::....|.   :.:||:|.::|..:||....||..|:||
 Frog  1262 YSGPQQLRQLASSCPPVAVCLA---RERLAGVDHTHVSSVEFNVVELADSMGWEMVPVKRALRDL 1323

  Fly  1393 EW-------VKVNGYPKRSPITVSFYDLGFRIKVPGDFTESEIDNALDTLYTRSVKQERTQLIQL 1450
            :|       .|..|   ||.:.|.|..|.|..:..||.|:.|:|...|.|:.:...:|||.|.||
 Frog  1324 QWKQQPERGFKGTG---RSGVLVEFGRLSFHFRSYGDLTDQELDEVCDFLHQKVTSRERTSLNQL 1385

  Fly  1451 QYVAHGLAAVAYSSCGQCCNADFPQDRGEQLKAIVRNYFANDYPQDLELEIEPSNVPDENIID-- 1513
            :.......:|||.:...|.. ....:|..||||::..||.....::.::|     .|||.:.:  
 Frog  1386 KSCFRAFQSVAYRTSSACAE-QISAERSAQLKALLWEYFEKRVTEEAKVE-----DPDEELREIK 1444

  Fly  1514 ----------DVHALINMYPDNTFTGRNIARIFHGIMSPNYPAVIWGR-CKFWRAHVKVDFNRIL 1567
                      |:...::::.:..|:||.:|||||||.||.|||.::|| .:|||.::.:|||.::
 Frog  1445 LQESKDQVRSDIRHFLSIHQEERFSGRALARIFHGIGSPCYPAQVFGRDRRFWRKYIHLDFNELM 1509

  Fly  1568 HLANMAIIK 1576
            :|:...||:
 Frog  1510 NLSKEEIIR 1518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 208/374 (56%)
DEAD 872..1039 CDD:278688 105/169 (62%)
HELICc 1073..1216 CDD:238034 85/160 (53%)
recql4NP_001072882.1 TFIIS_I 433..>547 CDD:294098 32/164 (20%)
ZnF_C2HC 606..621 CDD:197667 11/19 (58%)
RecQ 712..>1178 CDD:223588 229/468 (49%)
DEAD 723..876 CDD:278688 95/154 (62%)
HELICc 928..1085 CDD:238034 83/157 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C338390718
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D367596at33208
OrthoFinder 1 1.000 FOG0004747
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.