DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and WRN

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_000544.2 Gene:WRN HGNCID:12791 Length:1432 Species:Homo sapiens

Alignment Length:803 Identity:220/804 (27%)
Similarity:326/804 (41%) Gaps:213/804 (26%)


  Fly   542 PLNPEDLKYVLALE--AGDITSVPRINVQDLEEADATAQRYI-----RTFAAGPNPGLSEGSNIR 599
            ||. ||.|...|.:  ||.|.      .::||..|.|.||:.     ....:..|..|:..|...
Human   204 PLT-EDQKLYAATDAYAGFII------YRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEV 261

  Fly   600 VD--EKRAAARKKLEE----RIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKKQQWRHKKRVA 658
            :|  :....|..|||.    .|....::||..::    ::.:.|..::      :.:.|....:.
Human   262 MDLAKHLPHAFSKLENPRRVSILLKDISENLYSL----RRMIIGSTNI------ETELRPSNNLN 316

  Fly   659 ALSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSPFPTL--------- 714
            .||..|...||                 .||.:::...:|    ...||.:..|||         
Human   317 LLSFEDSTTGG-----------------VQQKQIREHEVL----IHVEDETWDPTLDHLAKHDGE 360

  Fly   715 ------AEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQESSGDEEV------- 766
                  .|.:|...:..|     ..::|.:....|.|...::.|.|....|....||.       
Human   361 DVLGNKVERKEDGFEDGV-----EDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYK 420

  Fly   767 -QQHPDPNWSSDEMDVDF-----EALDAAVEASLSQPVSQEKAASPIKTYV---GHKIPEEFLKQ 822
             .:|..||  .:|.|..:     |.|:..:...|| |...|...|    ||   ...:..|.|| 
Human   421 STEHLSPN--DNENDTSYVIESDEDLEMEMLKHLS-PNDNENDTS----YVIESDEDLEMEMLK- 477

  Fly   823 AGLDTTASSSNRSQHGGVKPLYDL---------LP-------------DGSVQD--------TTP 857
                    |......|.|:|.:..         ||             :|...|        ...
Human   478 --------SLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNE 534

  Fly   858 EVLEALHM-FGHTNFRKGQDRAIMRTL-SGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVI 920
            |.:..|.| |||::|:..|.:.|...| ....::..::||.|||||:|.|. :|   ||.|.|||
Human   535 EQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPP-VY---VGKIGLVI 595

  Fly   921 SPLVSLMEDQV-----TGVPH-FLRAHCLHTNQTAPQRMKIQQMIANGEIDILLVSPEAVVAGER 979
            |||:|||||||     :.:|. ||         .:.|...:...|..|:..|:.|:|      |.
Human   596 SPLISLMEDQVLQLKMSNIPACFL---------GSAQSENVLTDIKLGKYRIVYVTP------EY 645

  Fly   980 ATGFGAILRQLPP---IAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLP 1041
            .:|...:|:||..   |....:|||||:|:|.|:||.|:..:.. |:..|.:..::.|||||:..
Human   646 CSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGS-LKTALPMVPIVALTATASSS 709

  Fly  1042 TRVSIINHLGISDGE---RGIISDIPLPDNLVLSVSKDENRDAALLQLL------NSERFEPCQS 1097
            .|..|:..|.:.:.:   .|.  |.|   ||.|.|.:   :...:||.|      .|..:|....
Human   710 IREDIVRCLNLRNPQITCTGF--DRP---NLYLEVRR---KTGNILQDLQPFLVKTSSHWEFEGP 766

  Fly  1098 IIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSN 1162
            .||||..|...:::.|.:|                  ::|.....|||||..|.|:.:...|:.:
Human   767 TIIYCPSRKMTQQVTGELR------------------KLNLSCGTYHAGMSFSTRKDIHHRFVRD 813

  Fly  1163 ELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCH-LFLDAKGGDQSE 1226
            |::.|:|||||||||||.|||.||||..|::.|||.|||||||||||.|.|| |:..|       
Human   814 EIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPA------- 871

  Fly  1227 LRRHVYSNSIDRHVIRKLLQKIF 1249
                  ..:::||::.::..:.|
Human   872 ------DINLNRHLLTEIRNEKF 888

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 137/375 (37%)
DEAD 872..1039 CDD:278688 62/177 (35%)
HELICc 1073..1216 CDD:238034 61/150 (41%)
WRNNP_000544.2 Interaction with WRNIP1. {ECO:0000250} 2..277 23/80 (29%)
RNaseD_like 61..229 CDD:176650 11/32 (34%)
2 X 27 AA tandem repeats of H-L-S-P-N-D-N-E-N-D-T-S-Y-V-I-E-S-D-E-D-L-E-M-E-M-L-K 424..477 16/60 (27%)
recQ_fam 538..1010 CDD:129701 142/411 (35%)
DEAD 551..712 CDD:278688 63/181 (35%)
DEAH box 668..671 3/3 (100%)
HELICc 759..867 CDD:238034 55/126 (44%)
RecQ_Zn_bind 872..939 CDD:292742 3/18 (17%)
RQC 958..1051 CDD:214936
Interaction with DNA. {ECO:0000269|PubMed:20159463} 987..993
HRDC 1156..1229 CDD:128635
HTH_40 1261..1351 CDD:291179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.