DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and wrn

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_012810306.1 Gene:wrn XenbaseID:XB-GENE-992875 Length:1433 Species:Xenopus tropicalis

Alignment Length:651 Identity:193/652 (30%)
Similarity:293/652 (45%) Gaps:142/652 (22%)


  Fly   671 DGGVLTCFQCGGVGHFAQQCKVKGDSLLPLSAQLEEDPSPFPTLAEAQEMASQGAV---VAHSRN 732
            :|..|.|       |.::.|.             |||......|| ::|:.::..:   .|.|:|
 Frog   301 EGNGLLC-------HDSEDCS-------------EEDKYQSINLA-SKELLAENKIDYKNAESKN 344

  Fly   733 ISRLPQAANAAILQGDELNESEE--------DDQE--SSGDEEVQQHPDPNWSSD-----EMDVD 782
            ...:....|..:.| |.|..|||        ||::  ..|.:..:...|.|...:     |.|.:
 Frog   345 NKDVDCCQNENMKQ-DFLGISEEELYMMERKDDEKQIKPGQKSNEHLYDTNEEKNMSYIIESDEE 408

  Fly   783 FEA--------LDAAVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGG 839
            ||:        ||.::|.::...|.| ....|.|:               :||.|   :..:..|
 Frog   409 FESEIIKSLEDLDNSIEEAIGTSVHQ-TGLIPAKS---------------VDTVA---DEEEDEG 454

  Fly   840 VKPLYDLLP-DGSVQDTTPEVLEALH-MFGHTNFRKGQDRAIMRTL-SGLSSLVTLSTGSGKSLC 901
            ::...|... |.|:.:...|.:..|. .|||::|:..|.:.|...| ....:||.::||.|||||
 Frog   455 IEEEDDDDDWDPSIPEPNAEQVSCLKTYFGHSSFKPVQWKVIHSVLRERRDNLVVMATGYGKSLC 519

  Fly   902 YQLPAYLYSRKVGAITLVISPLVSLMEDQV-----TGVPH-FLRAHCLHTNQTAPQRMKIQQMIA 960
            ||. |.:|:..:|   :||.||:|||||||     :.:|. ||         .:.|...:.|.:.
 Frog   520 YQF-APVYTSGIG---IVICPLISLMEDQVLQLEMSNIPSCFL---------GSAQSKNVLQDVK 571

  Fly   961 NGEIDILLVSPEAVVAGERATGFGAILRQLP---PIAFACIDEAHCVSQWSHNFRPSYLMICKVL 1022
            .|.:.::.::||.      .:|..::|:.|.   .|....||||||:|:|.|:||.:|..:.. |
 Frog   572 AGRMRVIYMTPEF------CSGGISLLQDLDNRYGITLIAIDEAHCISEWGHDFRSAYRSLGS-L 629

  Fly  1023 RKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIIS-DIPLPDNLVLSVSKDENRDAALLQ- 1085
            ::.|....::.|||||:...|..|...|.:.:.:....| |.|   ||.|.|:|.....:..|| 
 Frog   630 KRMLPTVPIVALTATASPSIREDISKSLSLHNPQITCTSFDRP---NLYLDVAKKTTNISTDLQQ 691

  Fly  1086 -LLNSE----RFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHA 1145
             |:..:    .||  .:.|:||..|...|::              |.:.||    :......|||
 Frog   692 FLIKKQGSGWEFE--GATIVYCPTRKTSEQV--------------TAELTK----LGIACGTYHA 736

  Fly  1146 GMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLP 1210
            ||...:||.|...||.:|::.||||:||||||||||||.||||..|:..|||.||||||||||||
 Frog   737 GMGIKQRRDVHHRFMRDEIQCVVATVAFGMGINKPDIRKVIHYGAPKEMESYYQEIGRAGRDGLP 801

  Fly  1211 SHCH-LFLDAKGGDQSELRRHVYSNSIDRHVIRKL--LQKIFVPCSC----------DKEASKRT 1262
            |.|| |:..|.......:...:.:||...:.::.|  ::|.....:|          ||:..|.:
 Frog   802 SCCHALWTQADINFNRHMLGEIPNNSFREYKLKMLTKMEKYLNSSNCRRKIILSHFEDKQLRKAS 866

  Fly  1263 A 1263
            :
 Frog   867 S 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 138/373 (37%)
DEAD 872..1039 CDD:278688 59/177 (33%)
HELICc 1073..1216 CDD:238034 66/150 (44%)
wrnXP_012810306.1 WRN_exo 55..222 CDD:176653
recQ_fam 477..950 CDD:129701 148/435 (34%)
DEAD 490..651 CDD:278688 60/181 (33%)
HELICc <705..804 CDD:238034 56/117 (48%)
RecQ_Zn_bind 812..879 CDD:292742 8/57 (14%)
RQC 899..991 CDD:214936
HRDC 1098..1176 CDD:128635
HTH_40 1208..1298 CDD:291179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.