DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and BLM

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_000048.1 Gene:BLM HGNCID:1058 Length:1417 Species:Homo sapiens

Alignment Length:1155 Identity:287/1156 (25%)
Similarity:445/1156 (38%) Gaps:272/1156 (24%)


  Fly   204 SLSAKLFQSSRGFAKRNPRKPLSRCVSSSSSTTSLSSVPTDHHEELLDFETILIRKAQEYKEKQQ 268
            :|:.||..|...|:....:|..|...:.|.:..|::..|...::::...|.....:.......||
Human    20 TLNNKLSLSKPKFSGFTFKKKTSSDNNVSVTNVSVAKTPVLRNKDVNVTEDFSFSEPLPNTTNQQ 84

  Fly   269 AIAN---NPMLASEHSKESIKTLVDDGWLRRNTKENTLDEEVPFAEANNNSGTSKKTNFGLANLD 330
            .:.:   |.....|..:...|:|:.|  ..:..||...        ...|:.|.||:.    :..
Human    85 RVKDFFKNAPAGQETQRGGSKSLLPD--FLQTPKEVVC--------TTQNTPTVKKSR----DTA 135

  Fly   331 LSKLKPTVKEEKVLQAKPDQMAIIQELQTDMNSSMNQKPDHLNHTPPASS--QKSVAPKNK---- 389
            |.||:        ..:.||.::.|.:.. ||:.....:......|||.|.  :.|.|.|:|    
Human   136 LKKLE--------FSSSPDSLSTINDWD-DMDDFDTSETSKSFVTPPQSHFVRVSTAQKSKKGKR 191

  Fly   390 -----------------PPPS----------EQETDSD---------SDSVVAE---SEEEQEP- 414
                             ||||          ||:.||:         .|..:||   :|:.||. 
Human   192 NFFKAQLYTTNTVKTDLPPPSSESEQIDLTEEQKDDSEWLSSDVICIDDGPIAEVHINEDAQESD 256

  Fly   415 ------QEYRQLSKRRKIVSTASGKVEVAAPVEIPNKVEPETETFAQENPDFSADEDQDATYVPE 473
                  ::.|..|:::|.:..|    |:.:..::| .:|.:             |:|.|..:||.
Human   257 SLKTHLEDERDNSEKKKNLEEA----ELHSTEKVP-CIEFD-------------DDDYDTDFVPP 303

  Fly   474 NKKK-----DKAKRKQAAGKQKTTKPKAEPKPKTEKKAKVKAEKKPKAEKKPRNSKKAIAVEPAP 533
            :.::     ..:.:..:..|...|..:.|....|.|....|.||....|..|..|...       
Human   304 SPEEIISASSSSSKCLSTLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDC------- 361

  Fly   534 DPEEDERQPLNPEDLKYVLALEAGDITSVPRINVQDLEEADATAQRYIRTFAAGPNPGLSEGSNI 598
                |.||....:.|.:|:......|.::|...::.|:..:...|:                .||
Human   362 ----DARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQ----------------RNI 406

  Fly   599 RVDEKRAAARKKLEERIAAGKLNENFVTINIQKKKFVRGKKSVNFSKYKK----QQWRHKKRVAA 659
            |        ||.|.|                           |:|:|...    ..||:  |..:
Human   407 R--------RKLLTE---------------------------VDFNKSDASLLGSLWRY--RPDS 434

  Fly   660 LSGPDMDMGGCDGGVLTCFQCGGVGHFAQQCKVKGDSLLPLS----------AQLEEDPSPFPTL 714
            |.|| |:...|..|  ...:.....|........||.||..:          ..|.|.|. |.|.
Human   435 LDGP-MEGDSCPTG--NSMKELNFSHLPSNSVSPGDCLLTTTLGKTGFSATRKNLFERPL-FNTH 495

  Fly   715 AEAQEMASQGAVVAHSRNISRLPQAANAAILQGDELNESEEDDQ--ESSGDEEVQQHPDPNWSSD 777
            .:...::|..|      ...||.:...::...|:.|..:...||  .::...::::...|::..|
Human   496 LQKSFVSSNWA------ETPRLGKKNESSYFPGNVLTSTAVKDQNKHTASINDLERETQPSYDID 554

  Fly   778 EMDV-DFEALD---------AAVEASLS--QPVSQEKAASPIKTYVGHKIPEEFLKQAGLD---- 826
            ..|: ||:..|         ||.::|.:  ||:   |...|||:.      .|.|..|..|    
Human   555 NFDIDDFDDDDDWEDIMHNLAASKSSTAAYQPI---KEGRPIKSV------SERLSSAKTDCLPV 610

  Fly   827 -TTASSSNRSQHGGVKPLYDLLPDGSVQDT-----------------TPEVLEALH-MFGHTNFR 872
             :||.:.|.|:.      .....|.|.|:.                 |.|:::..| .||..|||
Human   611 SSTAQNINFSES------IQNYTDKSAQNLASRNLKHERFQSLSFPHTKEMMKIFHKKFGLHNFR 669

  Fly   873 KGQDRAIMRTLSGLSSLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHF 937
            ..|..||...|.|....:.:.||.||||||||||.:..    .:|:|||||.||:.|||..:...
Human   670 TNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSP----GVTVVISPLRSLIVDQVQKLTSL 730

  Fly   938 -LRAHCLHTNQTAPQRMKIQQMIANGE--IDILLVSPEAVVAGERATGFGAILRQLPPIAFACID 999
             :.|..|..::|..:...|...::..:  |.:|.|:||.:.|..|.......|.:...:|...||
Human   731 DIPATYLTGDKTDSEATNIYLQLSKKDPIIKLLYVTPEKICASNRLISTLENLYERKLLARFVID 795

  Fly  1000 EAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISDIP 1064
            ||||||||.|:||..|..: .:||:......|:.|||||....:..|:..|.|...:  :.|...
Human   796 EAHCVSQWGHDFRQDYKRM-NMLRQKFPSVPVMALTATANPRVQKDILTQLKILRPQ--VFSMSF 857

  Fly  1065 LPDNLVLSVSKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQ 1129
            ...||...|...:.:..|...|....:..|..|.||||..|.||:.:|..:              
Human   858 NRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGIIYCLSRRECDTMADTL-------------- 908

  Fly  1130 TKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNE-LRIVVATIAFGMGINKPDIRAVIHYNMPRN 1193
                :|....|..||||:..|.|..||:.:::.: .:::.|||||||||:|||:|.|||.::|::
Human   909 ----QRDGLAALAYHAGLSDSARDEVQQKWINQDGCQVICATIAFGMGIDKPDVRFVIHASLPKS 969

  Fly  1194 FESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRK 1243
            .|.|.||.|||||||..|||.||....  |.:.|:|.:.......|..|:
Human   970 VEGYYQESGRAGRDGEISHCLLFYTYH--DVTRLKRLIMMEKDGNHHTRE 1017

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 131/359 (36%)
DEAD 872..1039 CDD:278688 64/170 (38%)
HELICc 1073..1216 CDD:238034 55/144 (38%)
BLMNP_000048.1 BLM_N 1..366 CDD:292819 80/398 (20%)
Necessary for interaction with SPIDR. {ECO:0000269|PubMed:23509288} 301..600 75/382 (20%)
Necessary for dimerization and homooligomerization. {ECO:0000269|PubMed:28228481} 362..414 16/103 (16%)
BDHCT 372..409 CDD:285334 10/61 (16%)
BDHCT_assoc 425..647 CDD:292821 53/249 (21%)
recQ_fam 657..1143 CDD:129701 136/389 (35%)
DEAD 669..841 CDD:278688 64/177 (36%)
DEAH box 795..798 3/3 (100%)
HELICc 861..992 CDD:238034 57/149 (38%)
3' overhang DNA-binding. {ECO:0000269|PubMed:25901030} 870..873 0/3 (0%)
3' overhang DNA-binding. {ECO:0000244|PDB:4CGZ, ECO:0000244|PDB:4O3M, ECO:0000269|PubMed:24816114, ECO:0000269|PubMed:25901030} 897..899 1/2 (50%)
RecQ_Zn_bind 997..1066 CDD:292742 5/22 (23%)
3' overhang DNA-binding. {ECO:0000244|PDB:4CGZ, ECO:0000244|PDB:4O3M, ECO:0000269|PubMed:24816114, ECO:0000269|PubMed:25901030} 1000..1003 1/3 (33%)
RQC 1072..1189 CDD:286470
DNA Holliday junction binding. {ECO:0000269|PubMed:24257077} 1094..1139
3' overhang DNA-binding. {ECO:0000244|PDB:4CGZ, ECO:0000244|PDB:4O3M, ECO:0000269|PubMed:24816114, ECO:0000269|PubMed:25901030} 1110..1112
3' overhang DNA-binding. {ECO:0000244|PDB:4CGZ, ECO:0000244|PDB:4O3M, ECO:0000269|PubMed:24816114, ECO:0000269|PubMed:25901030} 1121..1125
3' overhang DNA-binding. {ECO:0000244|PDB:4CGZ, ECO:0000244|PDB:4O3M, ECO:0000269|PubMed:24816114, ECO:0000269|PubMed:25901030} 1160..1166
HRDC 1213..1292 CDD:128635
Necessary for ssDNA and DNA Holliday junction binding. {ECO:0000269|PubMed:20639533} 1227..1244
Nuclear localization signal. {ECO:0000255} 1334..1349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.