DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RecQ4 and RECQL

Sequence 1:NP_652607.1 Gene:RecQ4 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_002898.2 Gene:RECQL HGNCID:9948 Length:649 Species:Homo sapiens

Alignment Length:515 Identity:151/516 (29%)
Similarity:242/516 (47%) Gaps:109/516 (21%)


  Fly   784 EALDA------AVEASLSQPVSQEKAASPIKTYVGHKIPEEFLKQAGLDTTASSSNRSQHGGVKP 842
            |.||:      |||..:.:...:::.....|..:..||     ||...|:.|.:||.        
Human     9 EELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKI-----KQCLEDSDAGASNE-------- 60

  Fly   843 LYDLLP----------DGSVQDTTPEVLEALHMFGHTNFRKGQDRAIMRTLSGLSSLVTLSTGSG 897
             ||..|          .|.|:|    :|:  ::|....||..|...|..|::|....:.:.||.|
Human    61 -YDSSPAAWNKEDFPWSGKVKD----ILQ--NVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGG 118

  Fly   898 KSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQVTGVPHFLRAHCLHTNQTAPQRMK---IQQMI 959
            |||||||||....    ..||||.||:||||||:..:.....:..:....::.:.:|   .:.:.
Human   119 KSLCYQLPALCSD----GFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVN 179

  Fly   960 ANGEIDILLVSPEAVVAG-------ERATGFGAILRQLPPIAFACIDEAHCVSQWSHNFRPSYLM 1017
            .|.|:.::.|:||.:...       |:|  :.|  |:...||   :||.||.|||.|:|||.|..
Human   180 KNSELKLIYVTPEKIAKSKMFMSRLEKA--YEA--RRFTRIA---VDEVHCCSQWGHDFRPDYKA 237

  Fly  1018 ICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGER--------GIISDIPLPDNLVLSV- 1073
            : .:|::.....:::|||||||        ||: ::|.::        ...:....| ||...| 
Human   238 L-GILKRQFPNASLIGLTATAT--------NHV-LTDAQKILCIEKCFTFTASFNRP-NLYYEVR 291

  Fly  1074 ---SKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKR 1135
               |..|:....:::|:|. |::. ||.||||..:.:.|::                  |...:.
Human   292 QKPSNTEDFIEDIVKLING-RYKG-QSGIIYCFSQKDSEQV------------------TVSLQN 336

  Fly  1136 VNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQE 1200
            :...|..|||.:....:.||.:.:.:||:::||||:||||||:|||:|.|||::|.::.|:|.||
Human   337 LGIHAGAYHANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQE 401

  Fly  1201 IGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQKIFVPCSCDKEASK 1260
            .||||||.:.:.|.|:...  ||...:...|...::.:       ||::...|..:..||
Human   402 SGRAGRDDMKADCILYYGF--GDIFRISSMVVMENVGQ-------QKLYEMVSYCQNISK 452

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQ 864..>1218 CDD:223588 121/376 (32%)
DEAD 872..1039 CDD:278688 60/177 (34%)
HELICc 1073..1216 CDD:238034 52/147 (35%)
RECQLNP_002898.2 recQ_fam 81..543 CDD:129701 131/430 (30%)
DEAD 93..258 CDD:278688 60/177 (34%)
DEVH box 219..222 2/3 (67%)
HELICc 285..417 CDD:238034 54/152 (36%)
RecQ_Zn_bind 422..478 CDD:292742 7/39 (18%)
RQC 484..582 CDD:298958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.